Homologs in group_1012

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05145 FBDBKF_05145 100.0 Morganella morganii S1 tsaC L-threonylcarbamoyladenylate synthase
EHELCC_12445 EHELCC_12445 100.0 Morganella morganii S2 tsaC L-threonylcarbamoyladenylate synthase
LHKJJB_12645 LHKJJB_12645 100.0 Morganella morganii S3 tsaC L-threonylcarbamoyladenylate synthase
HKOGLL_11260 HKOGLL_11260 100.0 Morganella morganii S5 tsaC L-threonylcarbamoyladenylate synthase
F4V73_RS05600 F4V73_RS05600 93.2 Morganella psychrotolerans - L-threonylcarbamoyladenylate synthase
PMI_RS06470 PMI_RS06470 79.1 Proteus mirabilis HI4320 - L-threonylcarbamoyladenylate synthase

Distribution of the homologs in the orthogroup group_1012

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1012

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFR6 1.71e-120 342 74 0 206 3 yciO Uncharacterized protein YciO Shigella flexneri
P0AFR4 1.71e-120 342 74 0 206 1 yciO Uncharacterized protein YciO Escherichia coli (strain K12)
P0AFR5 1.71e-120 342 74 0 206 3 yciO Uncharacterized protein YciO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45103 2.17e-104 302 65 1 207 3 HI_1198 Uncharacterized protein HI_1198 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0VTD8 9.3e-20 85 26 3 169 3 tsaC Threonylcarbamoyl-AMP synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q970S6 1.77e-17 82 27 5 201 1 sua5 Threonylcarbamoyl-AMP synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8EKQ3 2.13e-17 79 29 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0I0R7 1.26e-16 77 29 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-7)
Q0HPA1 1.26e-16 77 29 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-4)
A0KR66 1.4e-16 77 29 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain ANA-3)
Q7MGL3 2.8e-16 76 25 3 161 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain YJ016)
Q8DDD6 2.8e-16 76 25 3 161 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain CMCP6)
A3QJE8 6.07e-16 75 27 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1RDY7 1.16e-15 75 27 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain W3-18-1)
A4Y1D2 1.16e-15 75 27 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WHB6 1.5e-15 74 27 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS185)
A3CYL0 1.5e-15 74 27 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1WZH9 2.22e-15 74 27 4 172 3 tsaC Threonylcarbamoyl-AMP synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q12TA0 3.52e-15 73 27 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9KUA7 1.09e-14 72 27 5 188 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS195)
Q83AA2 4.82e-14 70 25 4 162 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8P4F2 5.12e-14 70 26 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RWR5 5.12e-14 70 26 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQ07 5.12e-14 70 26 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain 8004)
A9N9G8 5.29e-14 70 27 2 129 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KH21 6.06e-14 70 27 2 129 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain Dugway 5J108-111)
A8GYH9 7.75e-14 70 27 7 187 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B3PGZ1 9.98e-14 69 27 3 159 3 tsaC Threonylcarbamoyl-AMP synthase Cellvibrio japonicus (strain Ueda107)
A1S1K5 1.18e-13 69 28 5 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q48AU1 1.28e-13 69 28 6 176 3 tsaC Threonylcarbamoyl-AMP synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B0TLD6 2.13e-13 68 27 3 180 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella halifaxensis (strain HAW-EB4)
A1KWL6 3.48e-13 68 27 4 166 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXA4 3.48e-13 68 27 4 166 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IP83 3.48e-13 68 27 4 166 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M4K6 3.48e-13 68 27 4 166 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C (strain 053442)
Q8PG13 5.45e-13 67 26 5 175 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas axonopodis pv. citri (strain 306)
Q3SG43 6.54e-13 67 28 5 167 3 tsaC Threonylcarbamoyl-AMP synthase Thiobacillus denitrificans (strain ATCC 25259)
A0KEX6 7.21e-13 67 25 4 171 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5F5I5 1.08e-12 67 28 4 166 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1QTJ8 1.41e-12 66 27 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3BNJ9 1.69e-12 66 26 5 175 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H5D8 1.74e-12 66 28 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL46 1.74e-12 66 28 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P833 1.74e-12 66 28 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q08A23 1.81e-12 66 24 4 167 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella frigidimarina (strain NCIMB 400)
Q31JQ7 2.53e-12 65 28 4 141 3 tsaC Threonylcarbamoyl-AMP synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A8FP81 3.15e-12 65 26 4 169 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sediminis (strain HAW-EB3)
Q0T019 4.04e-12 65 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri serotype 5b (strain 8401)
Q83JD1 4.85e-12 65 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri
Q8X8F8 5.06e-12 65 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O157:H7
Q3J7C4 5.64e-12 65 27 4 160 3 tsaC Threonylcarbamoyl-AMP synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B2FIS1 7.81e-12 64 26 2 145 3 tsaC Threonylcarbamoyl-AMP synthase Stenotrophomonas maltophilia (strain K279a)
A4ST51 7.81e-12 64 25 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas salmonicida (strain A449)
Q9KVT5 1e-11 64 24 5 176 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4C5 1e-11 64 24 5 176 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P39153 1e-11 66 24 4 191 1 ywlC Threonylcarbamoyl-AMP synthase Bacillus subtilis (strain 168)
A9MN84 1e-11 64 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7N129 1.05e-11 64 23 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio campbellii (strain ATCC BAA-1116)
P45748 1.07e-11 64 26 3 145 1 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12)
B1IQ17 1.07e-11 64 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A587 1.07e-11 64 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O9:H4 (strain HS)
B1X6D5 1.07e-11 64 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12 / DH10B)
A1SR31 1.13e-11 64 26 3 149 3 tsaC Threonylcarbamoyl-AMP synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q6LLJ9 1.24e-11 63 23 5 186 3 tsaC Threonylcarbamoyl-AMP synthase Photobacterium profundum (strain SS9)
Q3YWX6 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella sonnei (strain Ss046)
B2U2Q0 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R650 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain UTI89 / UPEC)
B1LGN9 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TCH9 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGH4 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O1:K1 / APEC
A7ZSH1 1.34e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q60369 1.39e-11 64 29 5 179 3 MJ0062 Putative threonylcarbamoyl-AMP synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q31VZ4 1.49e-11 63 26 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 4 (strain Sb227)
Q7P0L7 1.92e-11 63 27 4 182 3 tsaC Threonylcarbamoyl-AMP synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q87KE2 2.67e-11 63 24 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8ZLN0 3.31e-11 63 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N8A7 3.38e-11 63 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57J68 3.38e-11 63 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella choleraesuis (strain SC-B67)
Q0A5B4 3.38e-11 63 26 3 152 3 tsaC Threonylcarbamoyl-AMP synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6TET6 3.97e-11 62 23 5 181 3 tsaC Threonylcarbamoyl-AMP synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3IDH7 4.28e-11 62 25 5 178 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas translucida (strain TAC 125)
Q9UYB2 4.32e-11 64 27 5 178 1 sua5 Threonylcarbamoyl-AMP synthase Pyrococcus abyssi (strain GE5 / Orsay)
Q8FD17 7.17e-11 62 25 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B0U4N0 7.96e-11 62 22 4 174 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M12)
Q9PEV9 8.05e-11 62 24 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain 9a5c)
Q5PIS8 8.43e-11 62 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MPF3 9.72e-11 61 25 5 181 3 tsaC Threonylcarbamoyl-AMP synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q1H4G9 9.85e-11 61 24 3 167 3 tsaC Threonylcarbamoyl-AMP synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5QXJ5 1.14e-10 61 28 5 166 3 tsaC Threonylcarbamoyl-AMP synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15ZX7 1.21e-10 61 27 4 150 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8Z1W6 1.33e-10 61 26 3 134 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhi
A8AQH7 1.43e-10 61 26 2 136 3 tsaC Threonylcarbamoyl-AMP synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WF91 1.66e-10 61 25 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Enterobacter sp. (strain 638)
Q32B67 1.92e-10 60 25 3 145 3 tsaC Threonylcarbamoyl-AMP synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1KCX0 3.36e-10 60 24 5 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q21PU1 9.24e-10 58 23 5 177 3 tsaC Threonylcarbamoyl-AMP synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87AQ5 1.77e-09 58 23 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8S9 1.77e-09 58 23 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M23)
P57561 2.27e-09 57 26 5 166 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q5E1R5 3.01e-09 57 26 6 176 3 tsaC Threonylcarbamoyl-AMP synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8GKG1 4.31e-09 57 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Serratia proteamaculans (strain 568)
Q88RQ9 1.58e-08 55 22 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2SQW8 1.74e-08 55 26 3 138 3 tsaC Threonylcarbamoyl-AMP synthase Hahella chejuensis (strain KCTC 2396)
B1JJI2 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664V8 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH27 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis (strain Pestoides F)
Q1CCY0 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R933 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Angola)
Q74XX5 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis
B2K500 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2Y3 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ8 2.21e-08 55 23 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P9WGC9 2.97e-08 55 25 5 188 1 Rv1301 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGC8 2.97e-08 55 25 5 188 3 MT1340 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1TWN4 3.08e-08 54 23 3 164 3 tsaC Threonylcarbamoyl-AMP synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A5VWK1 3.24e-08 54 22 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4VFI1 3.34e-08 54 24 6 175 3 tsaC Threonylcarbamoyl-AMP synthase Stutzerimonas stutzeri (strain A1501)
B0KF32 4.29e-08 54 23 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain GB-1)
P45831 4.32e-08 54 24 5 200 3 ML1136 Putative threonylcarbamoyl-AMP synthase Mycobacterium leprae (strain TN)
Q0VC80 5.08e-08 55 26 6 179 2 YRDC Threonylcarbamoyl-AMP synthase Bos taurus
Q499R4 6.77e-08 54 27 6 179 2 Yrdc Threonylcarbamoyl-AMP synthase Rattus norvegicus
Q8D257 1.15e-07 53 24 5 177 3 tsaC Threonylcarbamoyl-AMP synthase Wigglesworthia glossinidia brevipalpis
Q493I0 1.65e-07 52 23 5 168 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella pennsylvanica (strain BPEN)
Q7VQB9 1.68e-07 52 22 2 131 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella floridana
A1JRY6 6.51e-07 51 22 5 163 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A5EW39 8.33e-07 50 26 2 131 3 tsaC Threonylcarbamoyl-AMP synthase Dichelobacter nodosus (strain VCS1703A)
Q4KKQ6 8.5e-07 50 22 6 183 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0VCB7 1.32e-06 50 23 7 185 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain AYE)
A3M154 1.32e-06 50 23 7 185 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNL3 1.32e-06 50 23 7 185 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain SDF)
B2I111 1.32e-06 50 23 7 185 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ACICU)
Q1I2G9 1.91e-06 49 22 6 184 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas entomophila (strain L48)
B1J499 2e-06 49 21 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain W619)
Q8K977 3.42e-06 49 24 7 174 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4XNB6 3.79e-06 48 23 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas mendocina (strain ymp)
A6VT87 4.75e-06 48 23 6 178 3 tsaC Threonylcarbamoyl-AMP synthase Marinomonas sp. (strain MWYL1)
Q500S6 6.43e-06 48 21 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. syringae (strain B728a)
Q48QH8 6.49e-06 48 21 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C1D9T5 6.49e-06 48 24 5 165 3 tsaC Threonylcarbamoyl-AMP synthase Laribacter hongkongensis (strain HLHK9)
Q3KKE2 7.89e-06 48 21 5 174 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain Pf0-1)
Q3U5F4 1.01e-05 48 29 6 179 1 Yrdc Threonylcarbamoyl-AMP synthase Mus musculus
Q603G8 2.07e-05 47 20 4 172 3 tsaC Threonylcarbamoyl-AMP synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2NQQ7 3.06e-05 46 25 3 140 3 tsaC Threonylcarbamoyl-AMP synthase Sodalis glossinidius (strain morsitans)
Q1LT55 4.03e-05 46 25 8 172 3 tsaC Threonylcarbamoyl-AMP synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q86U90 5.23e-05 46 28 6 179 1 YRDC Threonylcarbamoyl-AMP synthase Homo sapiens
Q88B46 5.91e-05 45 21 4 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q89A89 7.04e-05 45 22 5 185 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q65WC1 7.76e-05 45 22 2 136 3 tsaC Threonylcarbamoyl-AMP synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9I7A5 7.76e-05 45 20 7 180 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V59 7.76e-05 45 20 7 180 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B0UWV9 0.000143 44 22 2 136 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 2336)
Q0I1B6 0.000154 44 22 2 136 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 129Pt)
A6UX84 0.00019 43 21 7 180 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain PA7)
O94530 0.000229 44 21 6 219 3 sua5 Threonylcarbamoyl-AMP synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A3N1E4 0.000245 43 23 2 134 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BQ80 0.000277 43 23 2 134 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY27 0.000277 43 23 2 134 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q6FFH9 0.000528 42 21 4 179 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_12785
Feature type CDS
Gene tsaC
Product L-threonylcarbamoyladenylate synthase
Location 144278 - 144898 (strand: 1)
Length 621 (nucleotides) / 206 (amino acids)
In genomic island -

Contig

Accession ZDB_527
Length 181446 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1012
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01300 Telomere recombination

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0009 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine synthetase subunit TsaC/SUA5/YrdC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07566 L-threonylcarbamoyladenylate synthase [EC:2.7.7.87] - -

Protein Sequence

MGQMFYIHPDNPQARLINQSVEIFNKGGVVIYPTDSGYAIGCRLEDKDALQRICRLRQIDSNHNFTLMCRDLSDISTYAHVDNTVFRLIKNNTPGNYTFILRATKEVPRRLMSEKRKTIGLRIPANPIAMDLLAAMGEPLMSASLILPGNDFAESDPEEINDTLGKQVDLVIHGGYIGQQPTTVIDLTDDVPVVVREGTGDVTPFL

Flanking regions ( +/- flanking 50bp)

AATACCAATCTGGCAGGATTGGTCACTGAAGGATTAACAGAGGAAACAACATGGGCCAGATGTTTTATATCCATCCGGATAACCCGCAGGCACGCCTGATCAATCAGAGCGTGGAGATTTTTAACAAAGGCGGCGTAGTGATTTACCCGACCGATTCCGGCTATGCCATCGGCTGCCGCCTGGAAGATAAAGACGCGTTACAGCGGATCTGCCGTCTGCGTCAGATAGACAGTAATCATAACTTTACCCTGATGTGCCGCGATTTATCGGATATCTCCACCTATGCACATGTGGATAACACGGTATTCCGTTTAATCAAAAATAATACACCGGGTAATTACACCTTTATTCTGCGGGCAACCAAAGAAGTGCCGCGCCGTCTGATGAGTGAAAAACGTAAAACCATTGGTCTGCGTATTCCGGCAAACCCGATTGCGATGGATTTGCTTGCCGCAATGGGCGAACCGCTGATGTCGGCCAGTCTGATTTTACCGGGCAATGATTTTGCGGAATCTGATCCGGAAGAAATTAATGATACCCTGGGCAAGCAGGTGGACCTGGTGATCCACGGCGGTTATATCGGCCAGCAACCGACCACGGTTATCGATTTGACTGACGACGTGCCGGTTGTGGTGCGTGAAGGAACCGGAGATGTAACGCCGTTCCTGTGACCGCCATGTGCGTCACATGTGTAAAATGCGTTAGCGCCGTGCATTAACCT