Homologs in group_3423

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13800 FBDBKF_13800 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_11470 EHELCC_11470 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_11675 LHKJJB_11675 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_10285 HKOGLL_10285 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3423

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3423

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11815
Feature type CDS
Gene -
Product hypothetical protein
Location 138311 - 138418 (strand: 1)
Length 108 (nucleotides) / 35 (amino acids)

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3423
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MPLLINPPQHYTTGASFSMLKGITLTENYICQQTA

Flanking regions ( +/- flanking 50bp)

CATTCTGTATTGATATTACCGGATATTTTTATGCAGCGGGATATTATTTTATGCCGTTACTGATAAATCCCCCTCAGCACTATACAACCGGCGCTTCATTTTCTATGCTGAAAGGGATAACCCTGACAGAAAATTATATCTGTCAGCAGACTGCCTGATTTTATTATATAATCAATAATCGCGGACACGATGTTATCCGGTTATTTTA