Homologs in group_3490

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16845 FBDBKF_16845 100.0 Morganella morganii S1 - Repressor
EHELCC_10615 EHELCC_10615 100.0 Morganella morganii S2 - Repressor
LHKJJB_10395 LHKJJB_10395 100.0 Morganella morganii S3 - Repressor
HKOGLL_16560 HKOGLL_16560 100.0 Morganella morganii S5 - Repressor

Distribution of the homologs in the orthogroup group_3490

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3490

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10960
Feature type CDS
Gene -
Product Repressor
Location 145928 - 146149 (strand: 1)
Length 222 (nucleotides) / 73 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3490
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSQDKNLSVFSSRKHKGQALARIDRERKMLESGSHGVQRLVLNIAVDFIEKYPSMSWEQALAAAWGYCDRTYN

Flanking regions ( +/- flanking 50bp)

AAATGTGTATACCATCATTTTTTGCCTCTTACTACCTGGAGGCAATAATCATGTCACAAGATAAAAATCTCTCTGTATTCTCAAGCCGCAAACATAAAGGGCAGGCGTTAGCTCGTATTGACCGGGAACGTAAAATGCTGGAATCTGGTTCTCATGGTGTGCAACGTCTCGTGCTAAACATTGCTGTGGATTTCATTGAAAAGTATCCATCTATGAGTTGGGAACAAGCACTGGCCGCGGCTTGGGGCTATTGCGATCGTACTTACAACTAAGTATTGAGGATAATCAAAATGGCTAAAAAACAGGAAGTTAAGATTTTATA