Homologs in group_3292

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09185 FBDBKF_09185 100.0 Morganella morganii S1 rbsK Sugar or nucleoside kinase, ribokinase family
EHELCC_10225 EHELCC_10225 100.0 Morganella morganii S2 rbsK Sugar or nucleoside kinase, ribokinase family
LHKJJB_10785 LHKJJB_10785 100.0 Morganella morganii S3 rbsK Sugar or nucleoside kinase, ribokinase family
HKOGLL_13845 HKOGLL_13845 100.0 Morganella morganii S5 rbsK Sugar or nucleoside kinase, ribokinase family

Distribution of the homologs in the orthogroup group_3292

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3292

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76419 1.77e-72 229 44 3 305 3 yegV Uncharacterized sugar kinase YegV Escherichia coli (strain K12)
P44331 6.94e-11 65 26 9 321 3 rbsK Ribokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77493 2.3e-10 63 27 15 328 1 ydjH Uncharacterized sugar kinase YdjH Escherichia coli (strain K12)
Q92EQ5 6.24e-09 60 31 3 119 3 iolC 5-dehydro-2-deoxygluconokinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q65D02 1.39e-08 58 34 5 122 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P42414 2.16e-08 58 21 11 312 1 iolC 5-dehydro-2-deoxygluconokinase Bacillus subtilis (strain 168)
P50845 5.36e-08 57 25 14 319 2 kdgK 2-dehydro-3-deoxygluconokinase Bacillus subtilis (strain 168)
D9TT10 5.72e-08 57 20 8 292 1 pfkB ATP-dependent 6-phosphofructokinase Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032)
B8DCT6 7.35e-08 56 30 3 120 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4a (strain HCC23)
Q723S9 7.55e-08 56 30 3 120 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4b (strain F2365)
C1KZA1 7.55e-08 56 30 3 120 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4b (strain CLIP80459)
E9AD19 1.62e-07 55 20 5 307 1 LMJF_27_0420 Ribokinase Leishmania major
A1A6H3 2.06e-07 55 23 12 322 1 RBSK Ribokinase Arabidopsis thaliana
P36945 2.34e-07 55 24 9 311 3 rbsK Ribokinase Bacillus subtilis (strain 168)
P44482 2.69e-07 55 25 16 331 3 kdgK 2-dehydro-3-deoxygluconokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C1EVJ1 4.5e-07 54 31 1 98 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus cereus (strain 03BB102)
A0REB4 4.5e-07 54 31 1 98 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus thuringiensis (strain Al Hakam)
Q63B75 5.91e-07 53 31 2 106 3 iolC1 5-dehydro-2-deoxygluconokinase 1 Bacillus cereus (strain ZK / E33L)
A4IPB3 6.46e-07 53 29 2 107 3 iolC 5-dehydro-2-deoxygluconokinase Geobacillus thermodenitrificans (strain NG80-2)
Q8Y9Y2 9.94e-07 53 30 3 120 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q81QB7 1.57e-06 52 35 1 81 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis
C3LHY4 1.57e-06 52 35 1 81 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAZ0 1.57e-06 52 35 1 81 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis (strain A0248)
Q6HIK4 1.72e-06 52 35 1 81 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q4V1F7 1.84e-06 52 35 1 81 3 iolC2 5-dehydro-2-deoxygluconokinase 2 Bacillus cereus (strain ZK / E33L)
A7ZAH9 3.66e-06 51 30 5 132 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P57168 5.28e-06 50 27 2 141 3 BU060 Uncharacterized sugar kinase BU060 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O29891 6.05e-06 50 23 8 265 3 AF_0356 Uncharacterized sugar kinase AF_0356 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q5WKY9 6.17e-06 50 38 1 76 3 iolC 5-dehydro-2-deoxygluconokinase Shouchella clausii (strain KSM-K16)
O60116 6.64e-06 50 24 9 304 3 rbk1 Ribokinase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8KA54 8.66e-06 50 28 2 128 3 BUsg_057 Uncharacterized sugar kinase BUsg_057 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A3MZC0 1.15e-05 50 28 1 125 3 hldE Bifunctional protein HldE Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q8GLU7 1.16e-05 50 28 1 125 3 hldE Bifunctional protein HldE Actinobacillus pleuropneumoniae
A8APT1 1.55e-05 50 30 0 110 3 hldE Bifunctional protein HldE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P45416 2.09e-05 48 25 15 312 1 kdgK 2-dehydro-3-deoxygluconokinase Dickeya dadantii (strain 3937)
Q9KAG8 2.14e-05 49 35 1 76 1 iolC 5-dehydro-2-deoxygluconokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7LQC9 2.33e-05 49 30 0 110 3 hldE Bifunctional protein HldE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q53W83 2.79e-05 48 23 10 286 1 kdgK 2-dehydro-3-deoxygluconokinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A4WEI4 2.94e-05 48 30 0 110 3 hldE Bifunctional protein HldE Enterobacter sp. (strain 638)
Q5KYR3 2.99e-05 48 25 3 124 3 iolC 5-dehydro-2-deoxygluconokinase Geobacillus kaustophilus (strain HTA426)
Q9H477 3.88e-05 48 23 9 303 1 RBKS Ribokinase Homo sapiens
Q9CF42 4.13e-05 48 23 11 307 3 rbsK Ribokinase Lactococcus lactis subsp. lactis (strain IL1403)
Q32BR2 5.3e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella dysenteriae serotype 1 (strain Sd197)
B7ND40 5.3e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YR91 5.84e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q7AAQ7 5.84e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O157:H7
Q1R6S9 5.89e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain UTI89 / UPEC)
Q8FDH5 5.89e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFX4 5.89e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O1:K1 / APEC
B7N0K1 5.89e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O81 (strain ED1a)
B7MAC8 5.89e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O45:K1 (strain S88 / ExPEC)
Q7UBI8 6.11e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella flexneri
Q0T0L1 6.11e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella flexneri serotype 5b (strain 8401)
A8A4K6 6.11e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O9:H4 (strain HS)
B1LF43 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain SMS-3-5 / SECEC)
B6I423 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain SE11)
P76658 6.27e-05 48 30 0 110 1 hldE Bifunctional protein HldE Escherichia coli (strain K12)
B1IRR4 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD55 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG57 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain K12 / DH10B)
C4ZQW9 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZK1 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O8 (strain IAI1)
B7NJR5 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LGY7 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli (strain 55989 / EAEC)
B7UIW0 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRT3 6.27e-05 48 30 0 110 3 hldE Bifunctional protein HldE Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31WY3 6.44e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella boydii serotype 4 (strain Sb227)
B2U1F7 6.44e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YXJ0 6.74e-05 48 30 0 110 3 hldE Bifunctional protein HldE Shigella sonnei (strain Ss046)
P0A9J6 6.95e-05 47 26 9 312 1 rbsK Ribokinase Escherichia coli (strain K12)
P0A9J7 6.95e-05 47 26 9 312 3 rbsK Ribokinase Escherichia coli O157:H7
Q8R1Q9 7.13e-05 47 21 9 303 1 Rbks Ribokinase Mus musculus
A6TE31 0.000163 46 32 2 95 3 hldE Bifunctional protein HldE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q607M3 0.000183 46 34 2 95 3 hldE Bifunctional protein HldE Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B5XU40 0.000201 46 29 0 110 3 hldE Bifunctional protein HldE Klebsiella pneumoniae (strain 342)
Q55480 0.000212 46 25 9 273 3 slr0537 Uncharacterized sugar kinase slr0537 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A7MP93 0.000231 46 29 0 110 3 hldE Bifunctional protein HldE Cronobacter sakazakii (strain ATCC BAA-894)
A5UEH8 0.000242 46 25 1 124 3 hldE Bifunctional protein HldE Haemophilus influenzae (strain PittGG)
A5UCC3 0.000265 46 25 1 124 3 hldE Bifunctional protein HldE Haemophilus influenzae (strain PittEE)
Q4QKN8 0.000265 46 25 1 124 3 hldE Bifunctional protein HldE Haemophilus influenzae (strain 86-028NP)
O05074 0.000287 45 25 1 124 3 hldE Bifunctional protein HldE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C6DDL3 0.000325 45 30 0 110 3 hldE Bifunctional protein HldE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5FHT5 0.000337 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella dublin (strain CT_02021853)
Q7CPR9 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEW9 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella typhi
B4TVT4 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella schwarzengrund (strain CVM19633)
B5BG11 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella paratyphi A (strain AKU_12601)
C0PYX3 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella paratyphi C (strain RKS4594)
A9N5X8 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC86 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T670 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella newport (strain SL254)
B4TI51 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella heidelberg (strain SL476)
Q57JQ9 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella choleraesuis (strain SC-B67)
B5F696 0.000352 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella agona (strain SL483)
B5REF8 0.000365 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ36 0.000365 45 28 0 110 3 hldE Bifunctional protein HldE Salmonella enteritidis PT4 (strain P125109)
A9MPW3 0.000529 45 31 1 85 3 hldE Bifunctional protein HldE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A5G6F4 0.000784 44 28 2 128 3 hldE Bifunctional protein HldE Geotalea uraniireducens (strain Rf4)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10570
Feature type CDS
Gene rbsK
Product Sugar or nucleoside kinase, ribokinase family
Location 56652 - 57608 (strand: -1)
Length 957 (nucleotides) / 318 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3292
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00294 pfkB family carbohydrate kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0524 Carbohydrate transport and metabolism (G) G Sugar or nucleoside kinase, ribokinase family

Protein Sequence

MDVTLLTPQRPVVVIGAAFGDVMLEVNALPHSGDDISALPLGQQIGGCAFNVARALSRLGITPVNGIPAGNGSWGKQVTAAMEKENLPVLLRHPTHDNGWCLALVEESKERTFITIEGCEQHWSDALLAQIPVPDNALIYVSGYELVSPESAPLRNWLLAQSADKTLFADFGPRLRDIDPDFIEKLLAKKPLLTVNRDELAQLNPQGGKQSEIQTDDAQAFADSYGLPLIARFDKEGAVVCQPGQQPVRIPAYKVPVADTIAAGDSHCAGVLAGLACGQPLTDAVRTGNAVAAIVVSRPGSDGAPTRSELSEFLHHHL

Flanking regions ( +/- flanking 50bp)

CGTACCGCCTGACACTGATGATAAAACCGGTACGGAGTTAAACGGAACTGATGGATGTAACGTTACTGACACCACAGCGCCCGGTCGTGGTTATCGGCGCGGCTTTCGGCGATGTGATGCTGGAAGTGAATGCACTGCCGCACAGCGGGGATGATATCAGCGCCCTGCCGCTCGGGCAGCAGATCGGCGGCTGCGCCTTTAATGTCGCCCGCGCGCTGAGCCGTCTCGGTATTACACCGGTCAATGGCATTCCCGCCGGAAACGGCAGTTGGGGAAAACAGGTCACCGCCGCGATGGAAAAGGAAAATCTGCCGGTTCTGCTGCGCCATCCGACGCACGATAACGGCTGGTGTCTGGCGCTGGTGGAGGAAAGCAAAGAACGCACATTCATCACCATCGAAGGCTGTGAGCAGCACTGGAGTGACGCGCTGCTCGCACAAATTCCGGTACCGGACAATGCCCTGATTTATGTCTCCGGTTACGAACTGGTCAGTCCGGAAAGCGCGCCGCTGCGCAACTGGCTGCTGGCACAGAGTGCGGATAAAACCCTGTTTGCGGATTTCGGTCCGCGTCTGCGGGACATTGATCCGGACTTTATTGAAAAGCTGCTGGCGAAAAAGCCGCTGCTGACCGTCAACCGTGATGAGCTGGCACAGCTCAATCCGCAGGGCGGAAAACAGTCTGAGATACAGACAGACGATGCACAGGCGTTTGCCGACAGCTACGGCCTGCCGCTGATCGCCCGCTTTGATAAAGAAGGCGCTGTGGTGTGCCAGCCGGGACAACAGCCGGTCAGAATCCCGGCGTACAAAGTGCCGGTAGCCGATACCATTGCCGCCGGAGACAGCCACTGTGCCGGTGTTCTCGCCGGACTGGCCTGCGGACAACCGCTCACGGATGCCGTACGGACCGGTAATGCGGTGGCGGCCATTGTGGTCAGCCGCCCGGGCTCTGACGGCGCACCCACCCGCTCTGAACTGAGTGAGTTTTTACATCACCACCTCTGAAACACCGCCCGTTTACCCGACAGCGATGTTCACTCAGCCCCCGGATTCCG