Homologs in group_1449

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09215 FBDBKF_09215 100.0 Morganella morganii S1 fepD ABC-type Fe3+-siderophore transport system, permease component
EHELCC_10195 EHELCC_10195 100.0 Morganella morganii S2 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_10815 LHKJJB_10815 100.0 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_13875 HKOGLL_13875 100.0 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component
F4V73_RS10755 F4V73_RS10755 91.7 Morganella psychrotolerans - iron ABC transporter permease
PMI_RS13185 PMI_RS13185 74.4 Proteus mirabilis HI4320 - iron ABC transporter permease

Distribution of the homologs in the orthogroup group_1449

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1449

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57130 3.6e-62 204 37 4 333 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57552 1.02e-61 203 40 9 343 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O05731 9.99e-55 184 39 6 332 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW2 1.53e-53 181 39 6 332 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
Q56992 2.01e-53 181 36 9 322 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
O34451 9.64e-53 180 38 4 300 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
O34832 4.68e-44 157 36 9 335 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
O31569 1.58e-41 150 35 9 315 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
A9MFB6 2.86e-41 149 37 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TAH6 3.67e-41 149 33 5 289 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q32FI8 5.08e-41 149 37 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
P40410 8.74e-41 148 34 6 292 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
A8AHA4 1.59e-40 147 37 8 293 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BA35 5.96e-40 146 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 5.96e-40 146 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPS8 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 9.37e-40 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
Q8Z6I5 1.09e-39 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
Q57PU6 1.65e-39 145 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
B4T4N5 1.95e-39 144 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 1.95e-39 144 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 1.95e-39 144 36 8 293 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
Q3Z259 3.48e-39 144 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
P49937 8.89e-39 143 32 6 334 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
B7LQ78 2.3e-38 142 35 7 285 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8GDR2 2.51e-38 142 34 5 278 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
P15029 5.61e-38 140 38 9 291 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
O34933 9.76e-38 140 36 6 285 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
B7L6I4 1.6e-37 139 37 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
B2U360 1.74e-37 139 37 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IPL6 2.02e-37 139 37 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 2.02e-37 139 37 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
P40411 2.43e-37 139 32 11 342 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
B1JJ25 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 5.72e-37 138 32 6 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7N549 7.77e-37 138 36 8 297 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q81L64 1.63e-36 142 36 8 286 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 1.75e-23 104 30 5 292 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q0T4S1 1.65e-36 137 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B5YPZ9 1.81e-36 137 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 1.81e-36 137 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
Q8FH26 2.05e-36 137 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7M1C0 2.26e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 2.26e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I8R6 2.31e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
Q0THB7 2.78e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7C1M5 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
Q1RB84 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 3.06e-36 136 36 8 292 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 3.06e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MVJ0 3.46e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
Q321G8 4.09e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
B7US50 4.09e-36 136 36 8 292 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A1JPQ9 4.91e-36 136 34 9 284 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6LQ76 5.44e-36 135 33 7 290 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
O31568 5.86e-36 135 32 5 302 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q9HQ19 6.56e-36 136 42 5 269 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 6.56e-36 136 42 5 269 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q6D656 8.43e-36 135 33 4 277 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P49936 1.1e-35 136 35 5 281 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
Q47086 2.81e-31 123 32 6 317 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P15030 4.11e-31 122 33 7 318 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
Q7MLE7 2.28e-30 120 31 5 277 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q8D927 2.5e-30 120 31 5 277 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q8NX64 1.88e-29 118 32 6 303 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 1.88e-29 118 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
P23876 1.94e-29 118 37 7 289 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
P23877 2.14e-29 118 33 8 333 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q2YX91 2.87e-29 117 32 7 306 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KSL2 4.96e-29 117 29 6 334 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7N3Q3 1.34e-28 116 30 6 282 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6GHV2 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 3.92e-28 114 32 6 303 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 3.92e-28 114 32 6 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q47085 1.83e-27 113 36 5 280 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
Q2FZE5 2.2e-25 107 31 7 303 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
O87656 1.57e-24 107 36 7 272 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 4.18e-21 97 30 10 295 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87Q39 6.22e-23 100 30 8 265 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P06972 4.78e-20 94 30 9 279 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 7.97e-20 94 33 5 277 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P37738 7.77e-20 91 27 7 284 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
P94418 6.58e-19 89 24 8 337 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q58286 5.02e-16 81 23 10 326 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q81XB1 5.13e-13 72 26 11 295 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
P94419 1.2e-08 59 24 10 295 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
P37737 1.41e-08 58 24 11 287 1 fatC Ferric-anguibactin transport system permease protein FatC Vibrio anguillarum (strain ATCC 68554 / 775)
Q58287 8.18e-05 45 28 1 81 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10540
Feature type CDS
Gene fepD
Product ABC-type Fe3+-siderophore transport system, permease component
Location 50075 - 51088 (strand: -1)
Length 1014 (nucleotides) / 337 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1449
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0609 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-siderophore transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02015 iron complex transport system permease protein - -

Protein Sequence

MTTSVKTLLLLVLLVLVTGIALNVGKFSLTPQQLWDVVQAKITGNSGADDPALSRDMTVFWQIRLPRIAAALIIGGGLAIAGAAYQGMFRNPLVSPDILGVSAGAGVGAILGIFAGQSMLTIQLFAFTGGLCVVALVYSVARLARQHDPVLALVLVGIAVSALCGSAISLMKILADPYTQLPAMTFWLLGGLSAISPDDIKTTAPLIFAGMVPLLLLRWRMNLLSLSDEEARALGLNVSVTRLIFIASATLITASAVSVAGIIGWLGLIVPHITRLLVGANFSHQLPVSLLIGAIMLLLTDTLARTIAPIELPLGILTSAVGAPFFIFLLLQTRRNG

Flanking regions ( +/- flanking 50bp)

TATCACTCTCCACTGCCGGAGGCACAGATTAACAGTCTGTTATCTGCCCGATGACCACCTCCGTCAAAACCCTGTTACTGCTTGTGCTGCTGGTGCTGGTCACCGGCATTGCTCTGAATGTTGGTAAGTTCTCACTGACTCCACAGCAGCTGTGGGATGTGGTGCAGGCAAAAATCACCGGCAACAGCGGCGCGGATGATCCGGCGCTGAGCCGTGATATGACAGTCTTCTGGCAAATCCGTCTGCCGCGCATTGCCGCCGCACTGATTATCGGCGGCGGACTGGCGATAGCCGGGGCGGCGTATCAGGGCATGTTCCGTAACCCGCTGGTTTCACCGGATATCCTGGGTGTTTCCGCAGGTGCCGGGGTTGGTGCGATCCTAGGAATTTTTGCAGGTCAGTCAATGCTCACTATCCAGCTGTTCGCCTTCACCGGCGGGCTGTGTGTGGTTGCCCTGGTCTATTCTGTCGCCCGGCTGGCGCGTCAGCATGATCCGGTACTGGCGCTGGTGCTGGTCGGGATCGCTGTCAGTGCCCTGTGCGGCTCGGCCATTTCCCTGATGAAAATTCTGGCCGATCCCTATACCCAACTGCCCGCCATGACCTTCTGGCTGCTCGGCGGCCTGTCCGCGATTTCACCGGATGATATTAAAACCACCGCCCCGCTGATTTTCGCCGGGATGGTGCCGCTTCTGTTGCTGCGCTGGCGTATGAATCTGCTCAGCCTGAGTGATGAGGAAGCCCGTGCACTCGGGCTGAATGTCTCCGTGACGCGGCTGATTTTTATTGCCTCCGCCACCCTGATCACTGCCAGTGCGGTCTCTGTCGCGGGGATTATCGGCTGGCTCGGGCTGATTGTCCCGCATATCACCCGTTTGTTAGTGGGTGCCAACTTCAGCCACCAGTTGCCGGTGTCACTGCTGATCGGCGCCATCATGCTGCTGCTGACAGACACGCTCGCGCGTACTATTGCCCCGATTGAACTACCGCTCGGCATTCTGACCTCTGCGGTCGGTGCACCTTTCTTTATTTTTCTGCTGTTGCAGACCCGGAGGAACGGATGAGCGATGTCCTGACCACCCGCGGCCTGGCCGTCGGCTACGGAGAGAAGTTA