Homologs in group_3010

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17785 FBDBKF_17785 100.0 Morganella morganii S1 osmY Osmotically-inducible protein OsmY, contains BON domain
EHELCC_09810 EHELCC_09810 100.0 Morganella morganii S2 osmY Osmotically-inducible protein OsmY, contains BON domain
LHKJJB_07565 LHKJJB_07565 100.0 Morganella morganii S3 osmY Osmotically-inducible protein OsmY, contains BON domain
HKOGLL_07115 HKOGLL_07115 100.0 Morganella morganii S5 osmY Osmotically-inducible protein OsmY, contains BON domain
F4V73_RS15180 F4V73_RS15180 79.1 Morganella psychrotolerans - BON domain-containing protein

Distribution of the homologs in the orthogroup group_3010

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3010

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFH8 4.42e-13 66 41 1 94 1 osmY Osmotically-inducible protein Y Escherichia coli (strain K12)
P0AFH8 8.63e-05 43 39 0 61 1 osmY Osmotically-inducible protein Y Escherichia coli (strain K12)
P0AFH9 4.42e-13 66 41 1 94 3 osmY Osmotically-inducible protein Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH9 8.63e-05 43 39 0 61 3 osmY Osmotically-inducible protein Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7CPQ6 4.74e-06 47 42 1 61 2 dolP Outer membrane lipoprotein DolP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64596 8.58e-06 46 42 1 61 1 dolP Outer membrane lipoprotein DolP Escherichia coli (strain K12)
P64597 8.58e-06 46 42 1 61 3 dolP Outer membrane lipoprotein DolP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64598 8.58e-06 46 42 1 61 3 dolP Outer membrane lipoprotein DolP Escherichia coli O157:H7
P35664 0.000585 40 29 2 92 4 None Uncharacterized protein in gshII 5'region (Fragment) Anaplasma centrale

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10190
Feature type CDS
Gene osmY
Product Osmotically-inducible protein OsmY, contains BON domain
Location 198449 - 198853 (strand: -1)
Length 405 (nucleotides) / 134 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3010
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF04972 BON domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2823 Cell wall/membrane/envelope biogenesis (M) M Osmotically-inducible protein OsmY, contains BON domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04065 hyperosmotically inducible periplasmic protein - -

Protein Sequence

MRNTMKSLAVLLVSGALFSASAMAGESLSQKAGQAWDSASQSAEDLGKQAEQKFDGAVKDASLLVDDSTITAKIRGQLLSADDIDSNDIAVKTINGTVYLSGFVTTDAQRTKIIDIAKGVPGVRAVEVSIGQYK

Flanking regions ( +/- flanking 50bp)

ACACTGACAGACAGATGATGTTCATCATGAAAATGAAGAAGGATACGATAATGCGCAATACCATGAAATCACTGGCCGTCCTGCTGGTCAGCGGCGCGCTGTTCAGCGCATCCGCCATGGCGGGGGAATCTCTGAGTCAGAAAGCCGGCCAGGCGTGGGACAGTGCTTCTCAGTCTGCGGAAGATTTGGGTAAGCAGGCGGAGCAAAAATTTGACGGCGCGGTAAAAGATGCCTCACTGCTGGTGGATGACAGCACGATCACCGCCAAAATCCGTGGTCAGCTGCTGAGTGCGGATGATATTGACAGCAATGATATCGCCGTGAAAACCATTAACGGTACTGTGTATCTCTCCGGATTTGTTACCACAGATGCGCAGCGTACAAAAATCATCGATATTGCCAAAGGCGTTCCCGGTGTCCGTGCCGTGGAAGTCAGTATCGGGCAGTATAAATAACCGGCAGGTAATCTGCGCCGGGGGAAGAGCAGGATGGGAACGTATATCCC