Homologs in group_1133

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06040 FBDBKF_06040 100.0 Morganella morganii S1 - DUF3461 domain-containing protein
EHELCC_09085 EHELCC_09085 100.0 Morganella morganii S2 - DUF3461 domain-containing protein
LHKJJB_08290 LHKJJB_08290 100.0 Morganella morganii S3 - DUF3461 domain-containing protein
HKOGLL_07840 HKOGLL_07840 100.0 Morganella morganii S5 - DUF3461 domain-containing protein
F4V73_RS15865 F4V73_RS15865 95.3 Morganella psychrotolerans - DUF3461 family protein
PMI_RS11305 PMI_RS11305 88.0 Proteus mirabilis HI4320 - DUF3461 family protein

Distribution of the homologs in the orthogroup group_1133

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1133

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2D7 2.49e-74 219 83 2 131 3 PMI2289 UPF0325 protein PMI2289 Proteus mirabilis (strain HI4320)
Q7N8Q1 7.32e-71 211 81 2 131 3 plu0668 UPF0325 protein plu0668 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DAH9 2.53e-69 207 80 2 130 3 PC1_0937 UPF0325 protein PC1_0937 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D8E7 2.73e-68 204 80 2 130 3 ECA1027 UPF0325 protein ECA1027 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GIF0 6.5e-68 203 79 2 130 3 Spro_3794 UPF0325 protein Spro_3794 Serratia proteamaculans (strain 568)
A1JP87 1.67e-67 202 78 2 129 3 YE3288 UPF0325 protein YE3288 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1CAP0 3.15e-67 202 78 2 129 3 YPA_0514 UPF0325 protein YPA_0514 Yersinia pestis bv. Antiqua (strain Antiqua)
A9R399 3.15e-67 202 78 2 129 3 YpAngola_A3439 UPF0325 protein YpAngola_A3439 Yersinia pestis bv. Antiqua (strain Angola)
B2JZ38 3.15e-67 202 78 2 129 3 YPTS_3127 UPF0325 protein YPTS_3127 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q667I5 3.15e-67 202 78 2 129 3 YPTB3007 UPF0325 protein YPTB3007 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CFE1 3.15e-67 202 78 2 129 3 YPN_2962 UPF0325 protein YPN_2962 Yersinia pestis bv. Antiqua (strain Nepal516)
A4TL96 3.15e-67 202 78 2 129 3 YPDSF_1673 UPF0325 protein YPDSF_1673 Yersinia pestis (strain Pestoides F)
B1JQF6 3.15e-67 202 78 2 129 3 YPK_1062 UPF0325 protein YPK_1062 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q74S44 3.15e-67 202 78 2 129 3 YPO1040 UPF0325 protein YPO1040/y3141/YP_2811 Yersinia pestis
A7FFG5 3.15e-67 202 78 2 129 3 YpsIP31758_1009 UPF0325 protein YpsIP31758_1009 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3Z5J4 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella sonnei (strain Ss046)
P62771 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella flexneri
Q0T844 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella flexneri serotype 5b (strain 8401)
Q32JU4 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella dysenteriae serotype 1 (strain Sd197)
Q325X6 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella boydii serotype 4 (strain Sb227)
B2U306 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RG25 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain UTI89 / UPEC)
B1LGW6 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD9 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain SE11)
B7N832 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62768 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain K12)
P62770 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLG8 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K9 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O1:K1 / APEC
A7ZWB1 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O9:H4 (strain HS)
B1XD33 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain K12 / DH10B)
C4ZRQ6 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1A4 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O8 (strain IAI1)
B7MP25 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O81 (strain ED1a)
B7NIC6 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0E3 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62769 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O157:H7
B7LGM5 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain 55989 / EAEC)
B7MBE6 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIL0 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHQ5 3.56e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LWC4 3.89e-67 201 77 2 131 3 yaeH UPF0325 protein YaeH Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5Y1K6 1.4e-66 200 77 2 131 3 KPK_4555 UPF0325 protein KPK_4555 Klebsiella pneumoniae (strain 342)
A6T4W7 1.4e-66 200 77 2 131 3 KPN78578_01770 UPF0325 protein KPN78578_01770 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7CR64 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7ANK1 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella typhi
B4TXR6 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella schwarzengrund (strain CVM19633)
B5BL91 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella paratyphi A (strain AKU_12601)
A9N0Q9 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD51 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUZ3 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella newport (strain SL254)
B4TK39 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella heidelberg (strain SL476)
B5RHE9 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3H6 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella enteritidis PT4 (strain P125109)
B5FJ11 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella dublin (strain CT_02021853)
Q57T44 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella choleraesuis (strain SC-B67)
B5F8S5 2.65e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Salmonella agona (strain SL483)
B1IQH7 2.83e-66 199 76 2 131 3 yaeH UPF0325 protein YaeH Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8ALC5 5.23e-66 198 76 2 131 3 CKO_03204 UPF0325 protein CKO_03204 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C5BHB2 7.68e-66 198 78 2 131 3 NT01EI_0832 UPF0325 protein NT01EI_0832 Edwardsiella ictaluri (strain 93-146)
A7MGS2 1.62e-65 197 76 2 130 3 ESA_03178 UPF0325 protein ESA_03178 Cronobacter sakazakii (strain ATCC BAA-894)
Q2NRK3 1.93e-65 197 74 2 131 3 SG1947 UPF0325 protein SG1947 Sodalis glossinidius (strain morsitans)
A4W6R0 1.5e-64 195 75 2 130 3 Ent638_0703 UPF0325 protein Ent638_0703 Enterobacter sp. (strain 638)
A0KHF9 1.39e-51 162 64 2 128 3 AHA_1169 UPF0325 protein AHA_1169 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SQI6 2.08e-51 161 65 3 129 3 ASA_3165 UPF0325 protein ASA_3165 Aeromonas salmonicida (strain A449)
B7VIS1 1.1e-49 157 64 2 128 3 VS_2356 UPF0325 protein VS_2356 Vibrio atlanticus (strain LGP32)
Q6LN21 3.99e-48 153 60 2 128 3 PBPRA2971 UPF0325 protein PBPRA2971 Photobacterium profundum (strain SS9)
A7N1Y0 1.06e-46 150 60 2 128 3 VIBHAR_03240 UPF0325 protein VIBHAR_03240 Vibrio campbellii (strain ATCC BAA-1116)
Q87MD5 4.81e-46 148 60 2 128 3 VP2321 UPF0325 protein VP2321 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KPU8 1.01e-44 145 58 2 128 3 VC_2264 UPF0325 protein VC_2264 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MIF7 6.34e-44 142 57 2 128 3 VV2560 UPF0325 protein VV2560 Vibrio vulnificus (strain YJ016)
Q8DBG4 6.34e-44 142 57 2 128 3 VV1_1856 UPF0325 protein VV1_1856 Vibrio vulnificus (strain CMCP6)
B5F9X9 4.22e-43 140 60 3 128 3 VFMJ11_2099 UPF0325 protein VFMJ11_2099 Aliivibrio fischeri (strain MJ11)
Q5E3D6 4.22e-43 140 60 3 128 3 VF_1965 UPF0325 protein VF_1965 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1SSV2 7.43e-42 137 55 3 128 3 Ping_0715 UPF0325 protein Ping_0715 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q2SPM9 1.14e-35 122 49 3 132 3 HCH_00487 UPF0325 protein HCH_00487 Hahella chejuensis (strain KCTC 2396)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09465
Feature type CDS
Gene -
Product DUF3461 domain-containing protein
Location 35033 - 35419 (strand: 1)
Length 387 (nucleotides) / 128 (amino acids)
In genomic island -

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1133
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF11944 Protein of unknown function (DUF3461)

Protein Sequence

MYDNLKSLGITHPEDIDRYTLRQEANNDILKIYFRKDKGEFFAKSVKFKYPRQRKTIQDAQGFKEINEINSNLRYVIEELDTICQQTESAMPEIDLKRKILDDLRHLEHVVSNKIAEIESDLEKLTRK

Flanking regions ( +/- flanking 50bp)

CGCCTTTTGCGGCGGGAACAGGACAGAATAACAATCAATAGGTGGCGCACATGTACGACAATTTAAAAAGTCTGGGAATTACGCATCCTGAAGATATTGATCGCTATACTCTTCGTCAGGAAGCGAACAACGACATTCTGAAAATCTATTTCCGCAAGGATAAAGGCGAGTTTTTTGCCAAGAGCGTGAAGTTTAAGTACCCGCGTCAGCGCAAGACTATCCAGGATGCACAGGGTTTCAAAGAGATTAATGAGATCAACAGCAACCTGCGTTATGTCATCGAAGAGCTGGATACCATCTGCCAGCAGACCGAAAGCGCAATGCCGGAAATCGATCTGAAACGTAAGATCCTCGACGATCTCCGCCATCTGGAGCATGTGGTGTCCAATAAGATCGCTGAAATTGAAAGCGATCTGGAAAAACTGACCCGCAAGTAACCGGATGACACACTGCCGCAGTGCTGCAAAGCCGCTGCGGCGTTGTTTTC