Homologs in group_1846

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13420 FBDBKF_13420 100.0 Morganella morganii S1 rpmI 50S ribosomal protein L35
EHELCC_08675 EHELCC_08675 100.0 Morganella morganii S2 rpmI 50S ribosomal protein L35
LHKJJB_05265 LHKJJB_05265 100.0 Morganella morganii S3 rpmI 50S ribosomal protein L35
HKOGLL_05650 HKOGLL_05650 100.0 Morganella morganii S5 rpmI 50S ribosomal protein L35
F4V73_RS03345 F4V73_RS03345 96.9 Morganella psychrotolerans rpmI 50S ribosomal protein L35
PMI_RS05035 PMI_RS05035 96.9 Proteus mirabilis HI4320 rpmI 50S ribosomal protein L35

Distribution of the homologs in the orthogroup group_1846

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1846

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2VEL8 3.01e-39 126 96 0 65 3 rpmI Large ribosomal subunit protein bL35 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DFY8 4.68e-39 125 98 0 65 3 rpmI Large ribosomal subunit protein bL35 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4ETK8 7.18e-39 125 96 0 65 3 rpmI Large ribosomal subunit protein bL35 Proteus mirabilis (strain HI4320)
Q6D4H0 7.18e-39 125 96 0 65 3 rpmI Large ribosomal subunit protein bL35 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N3P8 2.6e-38 124 96 0 65 3 rpmI Large ribosomal subunit protein bL35 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NT30 8.41e-38 122 95 0 65 3 rpmI Large ribosomal subunit protein bL35 Sodalis glossinidius (strain morsitans)
B1JJ19 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z2 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL3 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pestis (strain Pestoides F)
Q1CIG5 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A6 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDW7 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pestis
B2K666 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C730 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG3 9.91e-38 122 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5B848 1.5e-37 122 95 0 65 3 rpmI Large ribosomal subunit protein bL35 Edwardsiella ictaluri (strain 93-146)
A1JMK4 2.64e-37 121 93 0 65 3 rpmI Large ribosomal subunit protein bL35 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3Z265 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Shigella sonnei (strain Ss046)
P0A7Q5 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Shigella flexneri
Q32FI2 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Shigella dysenteriae serotype 1 (strain Sd197)
Q321K8 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Shigella boydii serotype 4 (strain Sb227)
B2U395 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7Q3 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7Q4 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella typhi
B4TUF2 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella schwarzengrund (strain CVM19633)
A9N241 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH90 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N0 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella newport (strain SL254)
B4TGH3 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella heidelberg (strain SL476)
B5RAX1 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW6 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella enteritidis PT4 (strain P125109)
B5FJA6 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella dublin (strain CT_02021853)
Q57PV1 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella choleraesuis (strain SC-B67)
A9MFC1 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7G0 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Salmonella agona (strain SL483)
B5XQC8 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Klebsiella pneumoniae (strain 342)
B7LQ73 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB78 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain UTI89 / UPEC)
B1LE14 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain SMS-3-5 / SECEC)
B6IBD5 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain SE11)
B7N554 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7Q1 6.01e-37 120 92 0 65 1 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain K12)
B1IPL1 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0THB2 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A0R0 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O9:H4 (strain HS)
B1XG24 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain K12 / DH10B)
C4ZYH9 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C5 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O8 (strain IAI1)
B7MVJ5 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O81 (strain ED1a)
B7NT60 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ05 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7Q2 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O157:H7
B7L6J0 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli (strain 55989 / EAEC)
B7MAS7 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O45:K1 (strain S88 / ExPEC)
A7MNZ2 6.01e-37 120 92 0 65 3 rpmI Large ribosomal subunit protein bL35 Cronobacter sakazakii (strain ATCC BAA-894)
B7USA0 8.92e-37 120 90 0 65 3 rpmI Large ribosomal subunit protein bL35 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8GDQ7 5.77e-36 118 90 0 65 3 rpmI Large ribosomal subunit protein bL35 Serratia proteamaculans (strain 568)
A4W9M5 1.25e-35 117 90 0 65 3 rpmI Large ribosomal subunit protein bL35 Enterobacter sp. (strain 638)
C4K778 2.51e-33 111 84 0 65 3 rpmI Large ribosomal subunit protein bL35 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P67916 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Pasteurella multocida (strain Pm70)
P67917 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKK7 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Haemophilus influenzae (strain 86-028NP)
B8F7W5 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Glaesserella parasuis serovar 5 (strain SH0165)
B0BSM7 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H066 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYU6 2.17e-31 106 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VPB0 3.83e-31 105 83 0 65 3 rpmI Large ribosomal subunit protein bL35 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UU76 7.17e-31 105 81 0 65 3 rpmI Large ribosomal subunit protein bL35 Histophilus somni (strain 2336)
Q0I3J0 7.17e-31 105 81 0 65 3 rpmI Large ribosomal subunit protein bL35 Histophilus somni (strain 129Pt)
Q65TP8 9.23e-31 105 81 0 65 3 rpmI Large ribosomal subunit protein bL35 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKS1 3.85e-30 103 81 0 65 3 rpmI Large ribosomal subunit protein bL35 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4LFH1 2.46e-26 94 76 0 65 3 rpmI Large ribosomal subunit protein bL35 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q1LT06 3.91e-25 90 70 0 65 3 rpmI Large ribosomal subunit protein bL35 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IL79 8.39e-24 87 73 0 63 3 rpmI Large ribosomal subunit protein bL35 Pseudoalteromonas translucida (strain TAC 125)
A0KKP7 2.4e-23 86 72 0 65 3 rpmI Large ribosomal subunit protein bL35 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4Y704 2.64e-23 86 72 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q5QYN6 6.8e-23 85 67 0 65 3 rpmI Large ribosomal subunit protein bL35 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L2Q7 8.62e-23 84 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella baltica (strain OS195)
A6WNH0 8.62e-23 84 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella baltica (strain OS185)
A3D4I4 8.62e-23 84 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EES8 8.62e-23 84 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella baltica (strain OS223)
P49240 1.37e-22 84 75 0 64 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AV9 1.77e-22 84 68 0 64 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1S6G6 2.85e-22 83 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KG59 2.98e-22 83 69 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella woodyi (strain ATCC 51908 / MS32)
Q082E3 2.98e-22 83 69 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella frigidimarina (strain NCIMB 400)
Q0HV47 3.44e-22 83 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella sp. (strain MR-7)
Q0HIT7 3.44e-22 83 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella sp. (strain MR-4)
A0KWV6 3.44e-22 83 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella sp. (strain ANA-3)
Q8EER7 3.44e-22 83 70 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8FV58 5.51e-22 82 69 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella sediminis (strain HAW-EB3)
A3QEJ8 1.39e-21 81 67 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8H4U4 2.06e-21 81 67 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TT22 2.06e-21 81 67 1 65 3 rpmI Large ribosomal subunit protein bL35 Shewanella halifaxensis (strain HAW-EB4)
B4RSL6 3.46e-21 80 66 0 65 3 rpmI Large ribosomal subunit protein bL35 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B8GRI2 5.13e-21 80 65 0 64 3 rpmI Large ribosomal subunit protein bL35 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B8D732 5.13e-21 80 70 0 65 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57227 5.13e-21 80 70 0 65 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8S8 5.13e-21 80 70 0 65 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A5CWF7 8.69e-21 79 63 0 65 3 rpmI Large ribosomal subunit protein bL35 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q492V3 1.19e-20 79 62 0 64 3 rpmI Large ribosomal subunit protein bL35 Blochmanniella pennsylvanica (strain BPEN)
Q15SX5 1.3e-20 79 64 0 64 3 rpmI Large ribosomal subunit protein bL35 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q31F16 3.32e-20 78 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q057Z2 5.31e-20 77 65 0 64 3 rpmI Large ribosomal subunit protein bL35 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0VNG0 3.73e-19 75 66 1 65 3 rpmI Large ribosomal subunit protein bL35 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A7N011 4.35e-19 75 61 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio campbellii (strain ATCC BAA-1116)
Q60AZ2 5.32e-19 75 63 0 65 3 rpmI Large ribosomal subunit protein bL35 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87Q69 8.41e-19 74 60 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LUW0 1.66e-18 73 61 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio cholerae serotype O1 (strain M66-2)
O68845 1.66e-18 73 61 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5EZ16 1.66e-18 73 61 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SMA6 2.31e-18 73 73 0 65 3 rpmI Large ribosomal subunit protein bL35 Aeromonas salmonicida (strain A449)
Q9ALJ2 2.69e-18 73 61 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio metschnikovii
A6VYH9 3.28e-18 73 59 1 64 3 rpmI Large ribosomal subunit protein bL35 Marinomonas sp. (strain MWYL1)
A0Q760 3.29e-18 73 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. novicida (strain U112)
B0TY87 3.29e-18 73 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0AAL7 3.32e-18 73 56 0 65 3 rpmI Large ribosomal subunit protein bL35 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B6EN32 3.66e-18 73 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Aliivibrio salmonicida (strain LFI1238)
P66285 3.75e-18 73 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P66284 3.75e-18 73 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xylella fastidiosa (strain 9a5c)
B2I9P6 3.75e-18 73 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xylella fastidiosa (strain M23)
A4IX70 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGL6 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BL43 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. holarctica (strain OSU18)
B2SGS1 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A2J2 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. holarctica (strain LVS)
Q14I18 5.57e-18 72 61 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. tularensis (strain FSC 198)
Q3JC00 7.16e-18 72 60 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B4SQH2 7.32e-18 72 62 0 64 3 rpmI Large ribosomal subunit protein bL35 Stenotrophomonas maltophilia (strain R551-3)
B7VN19 9.5e-18 72 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio atlanticus (strain LGP32)
Q7MK67 1.07e-17 72 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio vulnificus (strain YJ016)
Q8DA11 1.07e-17 72 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Vibrio vulnificus (strain CMCP6)
B0U5E1 1.14e-17 72 59 0 64 3 rpmI Large ribosomal subunit protein bL35 Xylella fastidiosa (strain M12)
B5FDV3 1.22e-17 71 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Aliivibrio fischeri (strain MJ11)
Q5E5I4 1.22e-17 71 58 1 65 3 rpmI Large ribosomal subunit protein bL35 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7VR69 2.29e-17 71 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Blochmanniella floridana
B0TEV3 2.64e-17 70 62 0 64 3 rpmI Large ribosomal subunit protein bL35 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q5GXY2 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SUM1 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0Z7 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRT9 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66283 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH1 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas campestris pv. campestris (strain B100)
Q4UW55 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas campestris pv. campestris (strain 8004)
P66282 3.08e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Xanthomonas axonopodis pv. citri (strain 306)
A7NDB4 3.11e-17 70 60 0 65 3 rpmI Large ribosomal subunit protein bL35 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q6ANB9 6.57e-17 70 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8MI83 6.76e-17 70 62 0 64 3 rpmI Large ribosomal subunit protein bL35 Alkaliphilus oremlandii (strain OhILAs)
Q3SK32 7.25e-17 69 58 0 65 3 rpmI Large ribosomal subunit protein bL35 Thiobacillus denitrificans (strain ATCC 25259)
Q3A4P1 1.56e-16 68 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q1ITT1 1.7e-16 68 59 0 64 3 rpmI Large ribosomal subunit protein bL35 Koribacter versatilis (strain Ellin345)
B3E1T7 1.86e-16 68 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B5EN55 1.88e-16 68 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7S8 1.88e-16 68 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0SRT6 3.12e-16 68 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium perfringens (strain SM101 / Type A)
Q8XJ68 3.12e-16 68 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium perfringens (strain 13 / Type A)
Q0TP67 3.12e-16 68 60 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C6BRG9 3.36e-16 68 56 0 65 3 rpmI Large ribosomal subunit protein bL35 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1KSY4 4.67e-16 67 58 0 65 3 rpmI Large ribosomal subunit protein bL35 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66274 4.67e-16 67 58 0 65 3 rpmI Large ribosomal subunit protein bL35 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66273 4.67e-16 67 58 0 65 3 rpmI Large ribosomal subunit protein bL35 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F9U2 4.67e-16 67 58 0 65 3 rpmI Large ribosomal subunit protein bL35 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6TNP3 1e-15 67 61 0 63 3 rpmI Large ribosomal subunit protein bL35 Alkaliphilus metalliredigens (strain QYMF)
Q2SDJ4 1.27e-15 66 62 1 58 3 rpmI Large ribosomal subunit protein bL35 Hahella chejuensis (strain KCTC 2396)
C4XL13 1.43e-15 66 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q74D02 1.6e-15 66 56 0 64 3 rpmI Large ribosomal subunit protein bL35 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A6LTR4 1.69e-15 66 59 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5P7X7 1.74e-15 66 60 0 65 3 rpmI Large ribosomal subunit protein bL35 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q39VS7 2.08e-15 66 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C0QHL6 2.59e-15 65 58 0 63 3 rpmI Large ribosomal subunit protein bL35 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A0PZN3 2.98e-15 65 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium novyi (strain NT)
C1FA53 3.4e-15 65 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q480B1 4.66e-15 65 63 1 58 3 rpmI Large ribosomal subunit protein bL35 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7NYC4 1.17e-14 64 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2LR20 1.99e-14 63 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Syntrophus aciditrophicus (strain SB)
Q30Y13 2.05e-14 63 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1VBB6 2.08e-14 63 53 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitratidesulfovibrio vulgaris (strain DP4)
Q728R7 2.08e-14 63 53 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9I0A1 2.16e-14 63 61 1 62 1 rpmI Large ribosomal subunit protein bL35 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN9 2.16e-14 63 61 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V190 2.16e-14 63 61 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas aeruginosa (strain LESB58)
A6V487 2.16e-14 63 61 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas aeruginosa (strain PA7)
Q0ADN6 2.79e-14 63 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q189N0 4.22e-14 62 56 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridioides difficile (strain 630)
A1ARE3 5.5e-14 62 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1HWC9 7.1e-14 62 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Lysinibacillus sphaericus (strain C3-41)
B2V5A0 7.32e-14 62 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Alaska E43 / Type E3)
Q472N6 7.56e-14 62 53 0 65 3 rpmI Large ribosomal subunit protein bL35 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B5RR08 7.65e-14 62 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Borrelia recurrentis (strain A1)
B5RL15 7.65e-14 62 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Borrelia duttonii (strain Ly)
A1K4E3 7.99e-14 62 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Azoarcus sp. (strain BH72)
C0Z9B5 9.01e-14 62 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4J4Y9 9.6e-14 62 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q0AY03 1.03e-13 62 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q6F867 1.1e-13 62 60 1 64 3 rpmI Large ribosomal subunit protein bL35 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5G4T5 1.13e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Geotalea uraniireducens (strain Rf4)
A4IRN2 1.2e-13 61 53 0 62 3 rpmI Large ribosomal subunit protein bL35 Geobacillus thermodenitrificans (strain NG80-2)
A7GTM1 1.27e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A8FG26 1.4e-13 61 58 0 55 3 rpmI Large ribosomal subunit protein bL35 Bacillus pumilus (strain SAFR-032)
B0V5N7 1.41e-13 61 60 1 64 3 rpmI Large ribosomal subunit protein bL35 Acinetobacter baumannii (strain AYE)
B0VV92 1.41e-13 61 60 1 64 3 rpmI Large ribosomal subunit protein bL35 Acinetobacter baumannii (strain SDF)
B2HTH5 1.41e-13 61 60 1 64 3 rpmI Large ribosomal subunit protein bL35 Acinetobacter baumannii (strain ACICU)
B7I693 1.41e-13 61 60 1 64 1 rpmI Large ribosomal subunit protein bL35 Acinetobacter baumannii (strain AB0057)
B7H000 1.41e-13 61 60 1 64 3 rpmI Large ribosomal subunit protein bL35 Acinetobacter baumannii (strain AB307-0294)
Q1QWK5 1.61e-13 61 58 1 63 3 rpmI Large ribosomal subunit protein bL35 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B2TS60 1.63e-13 61 57 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Eklund 17B / Type B)
Q82VV3 1.65e-13 61 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A9VJN7 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus mycoides (strain KBAB4)
Q6HCV6 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633M2 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain ZK / E33L)
Q817H6 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9J074 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain Q1)
B7HRL3 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain AH187)
B7HF87 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain B4264)
C1EUR8 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain 03BB102)
B7IJX2 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain G9842)
Q72ZG3 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JR81 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus cereus (strain AH820)
Q81L16 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus anthracis
A0RJH3 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus thuringiensis (strain Al Hakam)
C3L8V2 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAG3 1.69e-13 61 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Bacillus anthracis (strain A0248)
P66277 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain MW2)
Q6G8P6 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain MSSA476)
Q6GG26 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain MRSA252)
P66276 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain N315)
P66275 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHL3 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain Newman)
Q5HF93 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain COL)
Q2YTB0 1.71e-13 61 53 0 64 1 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ITK4 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain JH9)
Q2FXQ0 1.71e-13 61 53 0 64 1 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FG57 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain USA300)
A6U2E7 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain JH1)
A7X3A2 1.71e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1GZR9 1.96e-13 61 52 0 63 3 rpmI Large ribosomal subunit protein bL35 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B8DPN0 2.12e-13 61 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B9M522 2.21e-13 61 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
P13069 2.24e-13 61 53 0 62 3 rpmI Large ribosomal subunit protein bL35 Geobacillus stearothermophilus
Q5KWD4 2.24e-13 61 53 0 62 3 rpmI Large ribosomal subunit protein bL35 Geobacillus kaustophilus (strain HTA426)
B9DNC5 2.5e-13 60 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus carnosus (strain TM300)
A1QYY4 4.32e-13 60 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Borrelia turicatae (strain 91E135)
Q5WT84 4.42e-13 60 71 0 45 3 rpmI Large ribosomal subunit protein bL35 Legionella pneumophila (strain Lens)
A5IAL1 4.42e-13 60 71 0 45 3 rpmI Large ribosomal subunit protein bL35 Legionella pneumophila (strain Corby)
Q5X1H5 4.42e-13 60 71 0 45 3 rpmI Large ribosomal subunit protein bL35 Legionella pneumophila (strain Paris)
C6DYJ3 4.66e-13 60 51 0 64 3 rpmI Large ribosomal subunit protein bL35 Geobacter sp. (strain M21)
B5EBY1 4.66e-13 60 51 0 64 3 rpmI Large ribosomal subunit protein bL35 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A5WHW7 4.82e-13 60 61 1 62 3 rpmI Large ribosomal subunit protein bL35 Psychrobacter sp. (strain PRwf-1)
Q2YBS4 4.98e-13 60 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B2RZQ0 5.38e-13 60 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Borrelia hermsii (strain HS1 / DAH)
A2SH05 5.96e-13 60 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q13WF9 6e-13 60 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Paraburkholderia xenovorans (strain LB400)
Q8EPF6 6.75e-13 59 50 0 63 3 rpmI Large ribosomal subunit protein bL35 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9K868 6.78e-13 59 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B8J4E2 6.92e-13 59 53 0 63 3 rpmI Large ribosomal subunit protein bL35 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B3R4J3 7.39e-13 59 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KBZ1 7.39e-13 59 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LP78 7.39e-13 59 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5WEI7 7.42e-13 59 51 0 64 3 rpmI Large ribosomal subunit protein bL35 Shouchella clausii (strain KSM-K16)
B2JJJ5 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JDU6 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SVE0 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63TM4 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia pseudomallei (strain K96243)
A3N8T3 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia pseudomallei (strain 668)
Q3JT11 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia pseudomallei (strain 1710b)
A3NUI6 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia pseudomallei (strain 1106a)
Q1BWV1 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia orbicola (strain AU 1054)
B1K093 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia orbicola (strain MC0-3)
A1V3R1 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia mallei (strain SAVP1)
Q62KI4 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia mallei (strain ATCC 23344)
A3MJU0 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia mallei (strain NCTC 10247)
Q39H53 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E7I7 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K6V2 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia cenocepacia (strain HI2424)
B1YP15 8.24e-13 59 55 0 65 3 rpmI Large ribosomal subunit protein bL35 Burkholderia ambifaria (strain MC40-6)
Q4FQ63 8.33e-13 59 61 1 62 3 rpmI Large ribosomal subunit protein bL35 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
P55874 9.95e-13 59 51 0 62 1 rpmI Large ribosomal subunit protein bL35 Bacillus subtilis (strain 168)
A0LFC4 1.03e-12 59 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q65GB4 1.11e-12 59 56 0 55 3 rpmI Large ribosomal subunit protein bL35 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2SZG0 1.15e-12 59 53 0 65 3 rpmI Large ribosomal subunit protein bL35 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q7VVR2 1.38e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7C9 1.38e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR7 1.38e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8D3B8 1.46e-12 58 63 1 65 3 rpmI Large ribosomal subunit protein bL35 Wigglesworthia glossinidia brevipalpis
Q0IE25 1.52e-12 58 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain CC9311)
A0L4J8 1.52e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A9BDA5 1.54e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9211)
C4L456 1.55e-12 58 56 0 55 3 rpmI Large ribosomal subunit protein bL35 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1L0T5 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Loch Maree / Type A3)
A7GI03 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IMV1 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Okra / Type B1)
C1FKM8 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Kyoto / Type A2)
A5I6L6 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KTJ8 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain 657 / Type Ba4)
A7FY85 1.79e-12 58 54 0 64 3 rpmI Large ribosomal subunit protein bL35 Clostridium botulinum (strain ATCC 19397 / Type A)
Q2KZL7 1.9e-12 58 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Bordetella avium (strain 197N)
Q49YB1 1.9e-12 58 51 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7UA42 1.92e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Parasynechococcus marenigrum (strain WH8102)
A7Z7H4 2.14e-12 58 56 0 55 3 rpmI Large ribosomal subunit protein bL35 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B9E783 2.29e-12 58 51 0 64 3 rpmI Large ribosomal subunit protein bL35 Macrococcus caseolyticus (strain JCSC5402)
B1XV12 2.36e-12 58 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4VM20 2.69e-12 58 62 1 58 3 rpmI Large ribosomal subunit protein bL35 Stutzerimonas stutzeri (strain A1501)
A1U2C1 2.74e-12 58 54 2 64 3 rpmI Large ribosomal subunit protein bL35 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7UZK2 3.24e-12 58 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A0AJP1 3.51e-12 58 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P0A491 3.51e-12 58 54 0 55 1 rpmI Large ribosomal subunit protein bL35 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDX3 3.51e-12 58 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Listeria monocytogenes serotype 4a (strain HCC23)
Q71YN4 3.51e-12 58 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Listeria monocytogenes serotype 4b (strain F2365)
C1KW83 3.51e-12 58 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Listeria monocytogenes serotype 4b (strain CLIP80459)
P0A492 3.51e-12 58 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A5D0U5 3.56e-12 58 55 0 63 3 rpmI Large ribosomal subunit protein bL35 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q8CS76 3.62e-12 58 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNM4 3.62e-12 58 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3B0U8 4.08e-12 57 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain CC9902)
B7GGV1 4.23e-12 57 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A8YWD3 4.32e-12 57 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus helveticus (strain DPC 4571)
B1J6U6 4.35e-12 57 58 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas putida (strain W619)
Q317Y1 5.13e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9312)
Q46IC9 5.48e-12 57 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain NATL2A)
A2C5C6 5.48e-12 57 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain NATL1A)
B2A5P0 5.66e-12 57 56 1 64 3 rpmI Large ribosomal subunit protein bL35 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q3ANJ5 5.86e-12 57 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain CC9605)
A4XTS3 5.91e-12 57 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas mendocina (strain ymp)
Q11UK1 5.97e-12 57 58 0 62 3 rpmI Large ribosomal subunit protein bL35 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q47CM6 6.05e-12 57 53 0 65 3 rpmI Large ribosomal subunit protein bL35 Dechloromonas aromatica (strain RCB)
Q88K25 6.11e-12 57 58 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR6 6.11e-12 57 58 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas putida (strain GB-1)
A5W5D9 6.11e-12 57 58 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IC13 6.11e-12 57 58 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas entomophila (strain L48)
A9IPU4 6.83e-12 57 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A5GHS0 6.98e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain WH7803)
Q83C12 7.04e-12 57 54 0 62 3 rpmI Large ribosomal subunit protein bL35 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KGB9 7.04e-12 57 54 0 62 3 rpmI Large ribosomal subunit protein bL35 Coxiella burnetii (strain Dugway 5J108-111)
B6IZF7 7.04e-12 57 54 0 62 3 rpmI Large ribosomal subunit protein bL35 Coxiella burnetii (strain CbuG_Q212)
B6J7Y0 7.04e-12 57 54 0 62 3 rpmI Large ribosomal subunit protein bL35 Coxiella burnetii (strain CbuK_Q154)
B2UGJ6 7.45e-12 57 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Ralstonia pickettii (strain 12J)
Q251I5 7.96e-12 57 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulfitobacterium hafniense (strain Y51)
B8FZK1 7.96e-12 57 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A2BTP2 8.05e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain AS9601)
A2BZ47 8.05e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9515)
A8G7G6 8.05e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9215)
Q7V998 8.41e-12 57 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9313)
A2C5Q7 8.41e-12 57 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9303)
Q5FIW8 8.52e-12 57 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A3PFE9 8.78e-12 57 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain MIT 9301)
B5YLD0 9.09e-12 57 48 0 64 3 rpmI Large ribosomal subunit protein bL35 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q74IC5 9.19e-12 57 50 0 63 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q041V2 9.19e-12 57 50 0 63 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
C5D637 9.19e-12 57 51 0 62 3 rpmI Large ribosomal subunit protein bL35 Geobacillus sp. (strain WCH70)
Q4L720 9.29e-12 57 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Staphylococcus haemolyticus (strain JCSC1435)
A1W8I4 9.52e-12 57 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Acidovorax sp. (strain JS42)
B9MHY0 9.52e-12 57 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Acidovorax ebreus (strain TPSY)
Q049G2 1.03e-11 57 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9B3 1.03e-11 57 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B2S487 1.16e-11 56 56 1 66 3 rpmI Large ribosomal subunit protein bL35 Treponema pallidum subsp. pallidum (strain SS14)
O83821 1.16e-11 56 56 1 66 3 rpmI Large ribosomal subunit protein bL35 Treponema pallidum (strain Nichols)
Q38VT3 1.29e-11 56 47 0 63 3 rpmI Large ribosomal subunit protein bL35 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8DH01 1.38e-11 56 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A6Q168 1.73e-11 56 59 1 62 3 rpmI Large ribosomal subunit protein bL35 Nitratiruptor sp. (strain SB155-2)
Q1Q8C5 1.75e-11 56 59 1 62 3 rpmI Large ribosomal subunit protein bL35 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7V9L2 2.04e-11 56 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B1YK03 2.15e-11 55 56 0 55 3 rpmI Large ribosomal subunit protein bL35 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9N8K3 2.35e-11 55 53 0 62 3 rpmI Large ribosomal subunit protein bL35 Coxiella burnetii (strain RSA 331 / Henzerling II)
O78496 2.72e-11 55 51 0 64 3 rpl35 Large ribosomal subunit protein bL35c Guillardia theta
B8HPI6 3.03e-11 55 46 0 64 3 rpmI Large ribosomal subunit protein bL35 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B8FFU1 3.06e-11 55 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulfatibacillum aliphaticivorans
B1I4I9 3.8e-11 55 64 0 64 3 rpmI Large ribosomal subunit protein bL35 Desulforudis audaxviator (strain MP104C)
A5GQ04 4.08e-11 55 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain RCC307)
B1XYZ5 4.08e-11 55 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A0T0F5 4.63e-11 55 46 0 64 3 rpl35 Large ribosomal subunit protein bL35c Phaeodactylum tricornutum (strain CCAP 1055/1)
Q4ZUG5 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas syringae pv. syringae (strain B728a)
P0A164 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas syringae pv. syringae
P0A163 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEY0 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas fluorescens (strain Pf0-1)
C3JZN5 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas fluorescens (strain SBW25)
Q4KEW2 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48JS1 5.05e-11 55 56 1 62 3 rpmI Large ribosomal subunit protein bL35 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7NBC1 5.76e-11 55 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A9KHG8 6.3e-11 54 50 0 64 3 rpmI Large ribosomal subunit protein bL35 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q0SNX4 6.67e-11 54 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Borreliella afzelii (strain PKo)
Q8XZ27 7.11e-11 54 50 0 65 3 rpmI Large ribosomal subunit protein bL35 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A0T0Q1 7.42e-11 54 48 0 64 3 rpl35 Large ribosomal subunit protein bL35c Thalassiosira pseudonana
Q662H5 8.12e-11 54 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A3DES7 8.38e-11 54 46 0 64 3 rpmI Large ribosomal subunit protein bL35 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8RQ00 8.74e-11 54 54 1 62 3 rpmI Large ribosomal subunit protein bL35 Azotobacter vinelandii
C1DF44 8.74e-11 54 54 1 62 3 rpmI Large ribosomal subunit protein bL35 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B7J1C2 9.06e-11 54 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Borreliella burgdorferi (strain ZS7)
O51207 9.06e-11 54 50 0 62 1 rpmI Large ribosomal subunit protein bL35 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A1TR37 1.07e-10 54 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Paracidovorax citrulli (strain AAC00-1)
A5N257 1.4e-10 53 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E5V9 1.4e-10 53 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Clostridium kluyveri (strain NBRC 12016)
A1WU55 1.43e-10 53 55 0 58 3 rpmI Large ribosomal subunit protein bL35 Halorhodospira halophila (strain DSM 244 / SL1)
A3CNY8 1.65e-10 53 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus sanguinis (strain SK36)
Q21KD8 1.67e-10 53 59 1 54 3 rpmI Large ribosomal subunit protein bL35 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A9C3D2 1.71e-10 53 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Delftia acidovorans (strain DSM 14801 / SPH-1)
A6L9S4 1.84e-10 53 53 0 58 3 rpmI Large ribosomal subunit protein bL35 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B9DU41 2.06e-10 53 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q1XDL6 2.24e-10 53 43 0 64 3 rpl35 Large ribosomal subunit protein bL35c Neopyropia yezoensis
Q12BR1 2.35e-10 53 50 0 63 3 rpmI Large ribosomal subunit protein bL35 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B3ERW0 2.42e-10 53 51 0 62 3 rpmI Large ribosomal subunit protein bL35 Amoebophilus asiaticus (strain 5a2)
B0BZS9 2.48e-10 53 46 0 65 3 rpmI Large ribosomal subunit protein bL35 Acaryochloris marina (strain MBIC 11017)
Q2JR50 2.51e-10 53 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain JA-3-3Ab)
B5XKT9 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE49 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U93 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF83 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7B7 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHJ6 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JME9 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCH1 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XCU1 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE48 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66280 2.89e-10 53 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M1
Q8DYU0 3.41e-10 53 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E4E8 3.41e-10 53 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0C9 3.41e-10 53 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q02X09 3.93e-10 52 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Lactococcus lactis subsp. cremoris (strain SK11)
A2RMR2 3.93e-10 52 54 0 55 1 rpmI Large ribosomal subunit protein bL35 Lactococcus lactis subsp. cremoris (strain MG1363)
A4VVU6 4.38e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus suis (strain 05ZYH33)
A4W252 4.38e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus suis (strain 98HAH33)
Q038A1 5.22e-10 52 46 0 63 3 rpmI Large ribosomal subunit protein bL35 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WF44 5.22e-10 52 46 0 63 3 rpmI Large ribosomal subunit protein bL35 Lacticaseibacillus casei (strain BL23)
B9L885 6e-10 52 53 0 62 3 rpmI Large ribosomal subunit protein bL35 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q2RYT6 6.35e-10 52 58 0 51 3 rpmI Large ribosomal subunit protein bL35 Salinibacter ruber (strain DSM 13855 / M31)
A8AX12 7.49e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C0MGL9 8.16e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2K0 8.16e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8T0 8.16e-10 52 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus equi subsp. equi (strain 4047)
B0K3V4 8.53e-10 52 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Thermoanaerobacter sp. (strain X514)
Q9CEJ8 8.73e-10 52 52 0 55 3 rpmI Large ribosomal subunit protein bL35 Lactococcus lactis subsp. lactis (strain IL1403)
C1CRU0 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CK41 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain P1031)
C1CDV5 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain JJA)
P66279 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IPB4 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain CGSP14)
P66278 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZP57 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IBC0 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain Hungary19A-6)
C1C6T7 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae (strain 70585)
B5E479 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae serotype 19F (strain G54)
Q04KW8 1.06e-09 51 48 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2RHN1 1.11e-09 51 48 0 64 3 rpmI Large ribosomal subunit protein bL35 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8RGH1 1.19e-09 51 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P49567 1.55e-09 51 48 0 64 3 rpl35 Large ribosomal subunit protein bL35c Trieres chinensis
A4SX35 1.83e-09 51 52 0 65 3 rpmI Large ribosomal subunit protein bL35 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8DV21 1.9e-09 51 46 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q21YT1 2.07e-09 51 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C5CUU4 2.19e-09 50 50 0 63 3 rpmI Large ribosomal subunit protein bL35 Variovorax paradoxus (strain S110)
Q029R4 2.28e-09 50 48 0 64 3 rpmI Large ribosomal subunit protein bL35 Solibacter usitatus (strain Ellin6076)
A1VR75 2.47e-09 50 49 0 63 3 rpmI Large ribosomal subunit protein bL35 Polaromonas naphthalenivorans (strain CJ2)
Q73KR2 2.52e-09 50 46 1 65 3 rpmI Large ribosomal subunit protein bL35 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8P1H7 2.72e-09 50 46 0 62 3 rpmI Large ribosomal subunit protein bL35 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q7NGV2 3.5e-09 50 45 0 64 3 rpmI Large ribosomal subunit protein bL35 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B0K8B4 3.78e-09 50 47 0 65 3 rpmI Large ribosomal subunit protein bL35 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q1WUN0 4.26e-09 50 44 0 63 3 rpmI Large ribosomal subunit protein bL35 Ligilactobacillus salivarius (strain UCC118)
A9ESS9 4.35e-09 50 46 0 65 3 rpmI Large ribosomal subunit protein bL35 Sorangium cellulosum (strain So ce56)
B3QUU9 4.74e-09 50 54 0 51 3 rpmI Large ribosomal subunit protein bL35 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B0S174 5.17e-09 50 44 0 63 3 rpmI Large ribosomal subunit protein bL35 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A4T9V0 5.18e-09 50 46 0 62 3 rpmI Large ribosomal subunit protein bL35 Mycolicibacterium gilvum (strain PYR-GCK)
Q7MVQ7 5.24e-09 50 51 1 64 3 rpmI Large ribosomal subunit protein bL35 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJD8 5.24e-09 50 51 1 64 3 rpmI Large ribosomal subunit protein bL35 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q2JI03 5.92e-09 50 47 0 63 3 rpmI Large ribosomal subunit protein bL35 Synechococcus sp. (strain JA-2-3B'a(2-13))
B5ZB37 7.27e-09 49 48 1 64 3 rpmI Large ribosomal subunit protein bL35 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A5FP03 7.36e-09 49 57 0 54 3 rpmI Large ribosomal subunit protein bL35 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q8AAP0 7.44e-09 49 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q5M471 7.78e-09 49 44 0 63 3 rpmI Large ribosomal subunit protein bL35 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q9Z6R8 8.56e-09 49 45 0 57 3 rpmI Large ribosomal subunit protein bL35 Chlamydia pneumoniae
Q64VP0 8.76e-09 49 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Bacteroides fragilis (strain YCH46)
Q5LEQ4 8.76e-09 49 50 0 62 3 rpmI Large ribosomal subunit protein bL35 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
P51270 8.76e-09 49 42 0 64 3 rpl35 Large ribosomal subunit protein bL35c Porphyra purpurea
A1WMG7 1.07e-08 49 46 0 65 3 rpmI Large ribosomal subunit protein bL35 Verminephrobacter eiseniae (strain EF01-2)
A7I0P0 1.08e-08 49 55 1 58 3 rpmI Large ribosomal subunit protein bL35 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A4G617 1.14e-08 49 49 0 65 3 rpmI Large ribosomal subunit protein bL35 Herminiimonas arsenicoxydans
C4ZBG2 1.23e-08 48 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B2G8A8 1.28e-08 48 42 0 64 3 rpmI Large ribosomal subunit protein bL35 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKX3 1.28e-08 48 42 0 64 3 rpmI Large ribosomal subunit protein bL35 Limosilactobacillus reuteri (strain DSM 20016)
P47439 1.56e-08 48 51 0 52 3 rpmI Large ribosomal subunit protein bL35 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q03KJ0 1.62e-08 48 50 0 55 3 rpmI Large ribosomal subunit protein bL35 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LZL8 1.62e-08 48 50 0 55 3 rpmI Large ribosomal subunit protein bL35 Streptococcus thermophilus (strain CNRZ 1066)
B2KB84 1.67e-08 48 50 0 50 3 rpmI Large ribosomal subunit protein bL35 Elusimicrobium minutum (strain Pei191)
A6GY20 1.78e-08 48 54 0 55 3 rpmI Large ribosomal subunit protein bL35 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A4XKC0 1.93e-08 48 45 0 64 3 rpmI Large ribosomal subunit protein bL35 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q04EH0 2.06e-08 48 49 0 55 3 rpmI Large ribosomal subunit protein bL35 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A0PP59 2.53e-08 48 45 0 62 3 rpmI Large ribosomal subunit protein bL35 Mycobacterium ulcerans (strain Agy99)
B2HR13 2.53e-08 48 45 0 62 3 rpmI Large ribosomal subunit protein bL35 Mycobacterium marinum (strain ATCC BAA-535 / M)
A8EQY4 2.53e-08 48 52 1 59 3 rpmI Large ribosomal subunit protein bL35 Aliarcobacter butzleri (strain RM4018)
A0RM91 2.85e-08 48 51 1 58 3 rpmI Large ribosomal subunit protein bL35 Campylobacter fetus subsp. fetus (strain 82-40)
O66982 3.37e-08 48 55 0 60 3 rpmI Large ribosomal subunit protein bL35 Aquifex aeolicus (strain VF5)
B9MRK1 3.47e-08 47 45 0 64 3 rpmI Large ribosomal subunit protein bL35 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A1R567 3.71e-08 47 46 0 62 3 rpmI Large ribosomal subunit protein bL35 Paenarthrobacter aurescens (strain TC1)
Q9PQR3 4.14e-08 47 46 1 64 3 rpmI Large ribosomal subunit protein bL35 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIL7 4.14e-08 47 46 1 64 3 rpmI Large ribosomal subunit protein bL35 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A0LYZ1 4.88e-08 47 55 0 54 3 rpmI Large ribosomal subunit protein bL35 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A0QYU7 5.03e-08 47 50 0 54 1 rpmI Large ribosomal subunit protein bL35 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q04ZH0 5.21e-08 47 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U55 5.21e-08 47 53 0 64 3 rpmI Large ribosomal subunit protein bL35 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q255M2 5.38e-08 47 43 0 57 3 rpmI Large ribosomal subunit protein bL35 Chlamydia felis (strain Fe/C-56)
Q822B3 5.38e-08 47 43 0 57 3 rpmI Large ribosomal subunit protein bL35 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L5A6 5.38e-08 47 43 0 57 3 rpmI Large ribosomal subunit protein bL35 Chlamydia abortus (strain DSM 27085 / S26/3)
C5CAP9 6.47e-08 47 47 0 55 3 rpmI Large ribosomal subunit protein bL35 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09000
Feature type CDS
Gene rpmI
Product 50S ribosomal protein L35
Location 213357 - 213554 (strand: 1)
Length 198 (nucleotides) / 65 (amino acids)
In genomic island -

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1846
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01632 Ribosomal protein L35

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0291 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L35

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02916 large subunit ribosomal protein L35 Ribosome -

Protein Sequence

MPKIKTVRGAAKRFKKTAKGGFKRKHANLRHILTKKSTKRKRHLRPKGMVSKGDLGLVVACLPYA

Flanking regions ( +/- flanking 50bp)

TTTATTCGCCGGATTAATTCGTTGTTTAACAATGCGAAGTGGAAATAAAAATGCCAAAGATTAAAACTGTACGTGGTGCAGCTAAGCGTTTCAAAAAAACCGCTAAAGGTGGTTTCAAGCGTAAGCATGCTAACCTCCGTCATATTCTGACTAAAAAATCAACTAAGCGTAAACGTCATTTACGTCCGAAAGGTATGGTCTCCAAAGGGGATCTGGGTTTAGTTGTCGCTTGCCTGCCATACGCATAAGCAAGTTTTTTAGCAAAGTTTACGACTTTAGGAGATTAGTATGGCTCGTG