Homologs in group_808

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03255 FBDBKF_03255 100.0 Morganella morganii S1 hpf ribosome hibernation promoting factor
EHELCC_07280 EHELCC_07280 100.0 Morganella morganii S2 hpf ribosome hibernation promoting factor
LHKJJB_07140 LHKJJB_07140 100.0 Morganella morganii S3 hpf ribosome hibernation promoting factor
HKOGLL_03790 HKOGLL_03790 100.0 Morganella morganii S5 hpf ribosome hibernation promoting factor
F4V73_RS11665 F4V73_RS11665 92.6 Morganella psychrotolerans hpf ribosome hibernation promoting factor
PMI_RS18145 PMI_RS18145 74.7 Proteus mirabilis HI4320 hpf ribosome hibernation promoting factor

Distribution of the homologs in the orthogroup group_808

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_808

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P17161 3.44e-40 130 63 0 93 3 hpf Ribosome hibernation promoting factor Klebsiella oxytoca
P26983 6.36e-39 127 62 0 93 3 hpf Ribosome hibernation promoting factor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFX3 9.75e-39 127 63 0 93 3 hpf Ribosome hibernation promoting factor Shigella flexneri
P0AFX0 9.75e-39 127 63 0 93 1 hpf Ribosome hibernation promoting factor Escherichia coli (strain K12)
P0AFX1 9.75e-39 127 63 0 93 3 hpf Ribosome hibernation promoting factor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFX2 9.75e-39 127 63 0 93 3 hpf Ribosome hibernation promoting factor Escherichia coli O157:H7
P17160 1.53e-29 104 56 0 91 3 hpf Ribosome hibernation promoting factor Azotobacter vinelandii
P0A148 7.22e-28 100 52 0 91 3 hpf Ribosome hibernation promoting factor Pseudomonas putida
P0A147 7.22e-28 100 52 0 91 3 hpf Ribosome hibernation promoting factor Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P28613 3.23e-15 68 33 1 99 3 hpf Ribosome hibernation promoting factor Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P33987 2.46e-14 65 37 2 100 3 hpf Ribosome hibernation promoting factor Acinetobacter guillouiae
P0AD52 5.76e-12 60 38 1 95 3 yfiA Ribosome-associated factor Y Shigella flexneri
P0AD49 5.76e-12 60 38 1 95 1 raiA Ribosome-associated inhibitor A Escherichia coli (strain K12)
P0AD50 5.76e-12 60 38 1 95 3 yfiA Ribosome-associated factor Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD51 5.76e-12 60 38 1 95 3 yfiA Ribosome-associated factor Y Escherichia coli O157:H7
P47995 1.18e-10 58 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus carnosus (strain TM300)
Q9RVE7 1.27e-10 58 34 1 95 1 hpf Ribosome hibernation promotion factor Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P28368 1.28e-10 58 40 4 96 1 yvyD Ribosome hibernation promotion factor Bacillus subtilis (strain 168)
P24694 1.45e-10 55 32 1 78 3 hpf Ribosome hibernation promoting factor (Fragment) Acidithiobacillus ferridurans
P74518 1.79e-10 57 32 2 101 3 hpf Ribosome hibernation promotion factor Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A2RIX0 1.83e-10 57 35 2 96 1 hpf Ribosome hibernation promotion factor Lactococcus lactis subsp. cremoris (strain MG1363)
Q5XAQ7 2.93e-10 57 34 3 96 1 hpf Ribosome hibernation promotion factor Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8CTF2 1.31e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQX7 1.31e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A1G5 1.41e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain MW2)
Q6GB78 1.41e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain MSSA476)
Q6GIN9 1.41e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain MRSA252)
Q7A6R6 1.41e-09 55 31 1 95 1 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain N315)
Q99VM3 1.41e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSH7 1.41e-09 55 31 1 95 1 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G055 1.41e-09 55 31 1 95 1 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIN9 1.41e-09 55 31 1 95 1 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain USA300)
Q5HHR8 1.49e-09 55 31 1 95 3 hpf Ribosome hibernation promotion factor Staphylococcus aureus (strain COL)
A0A0H3GEZ8 1.84e-09 55 35 3 96 1 hpf Ribosome hibernation promotion factor Listeria monocytogenes serotype 1/2a (strain 10403S)
P47908 2.22e-09 54 34 2 97 2 hpf Ribosome hibernation promotion factor Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P71346 7.82e-09 51 35 0 95 1 yfiA Ribosome-associated factor Y Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L4H7 1.66e-08 52 33 2 96 3 hpf Ribosome hibernation promotion factor Staphylococcus haemolyticus (strain JCSC1435)
Q49VV1 2e-08 52 31 1 92 3 hpf Ribosome hibernation promotion factor Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P30334 0.000628 40 25 2 97 3 hpf Ribosome hibernation promotion factor Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07605
Feature type CDS
Gene hpf
Product ribosome hibernation promoting factor
Location 194578 - 194865 (strand: -1)
Length 288 (nucleotides) / 95 (amino acids)
In genomic island -

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_808
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02482 Sigma 54 modulation protein / S30EA ribosomal protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1544 Translation, ribosomal structure and biogenesis (J) J Ribosome-associated translation inhibitor RaiA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05808 ribosome hibernation promoting factor - -

Protein Sequence

MELQITGHNVEITDALRETVTAKCKKLEQFFDKINSVQVILRIEKVSKIAEATAQVNGADLHASAEKEDMYAAIDEMAEKLGRQLSKHKEKLRNR

Flanking regions ( +/- flanking 50bp)

TCAAATCAGCGTAAACAGCTGATTTGATACACATTGAGAAGGAAGACACTATGGAATTACAAATTACCGGCCACAACGTTGAAATTACAGACGCATTACGTGAGACTGTGACAGCCAAGTGTAAGAAACTGGAGCAGTTTTTCGATAAAATTAACAGCGTTCAGGTGATCCTGCGGATTGAAAAGGTGAGTAAAATTGCGGAGGCAACGGCTCAGGTAAACGGTGCGGATCTTCACGCCTCAGCGGAAAAAGAGGATATGTACGCGGCAATTGATGAGATGGCAGAAAAACTCGGCCGTCAGTTGTCCAAACACAAAGAAAAACTGAGAAACCGGTAAATTTTCTGCACCCGGGTGCATGACTGAATTAACAGTCTGAATTTTCTCAG