Homologs in group_738

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03265 FBDBKF_03265 100.0 Morganella morganii S1 rapZ RNase adapter RapZ
EHELCC_07270 EHELCC_07270 100.0 Morganella morganii S2 rapZ RNase adapter RapZ
LHKJJB_07130 LHKJJB_07130 100.0 Morganella morganii S3 rapZ RNase adapter RapZ
HKOGLL_03800 HKOGLL_03800 100.0 Morganella morganii S5 rapZ RNase adapter RapZ
F4V73_RS11655 F4V73_RS11655 97.2 Morganella psychrotolerans rapZ RNase adapter RapZ
PMI_RS18135 PMI_RS18135 94.3 Proteus mirabilis HI4320 rapZ RNase adapter RapZ

Distribution of the homologs in the orthogroup group_738

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_738

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N053 0.0 563 96 0 283 3 rapZ RNase adapter protein RapZ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GK24 0.0 562 96 0 283 3 rapZ RNase adapter protein RapZ Serratia proteamaculans (strain 568)
A1JRD2 0.0 560 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WF18 0.0 559 95 0 283 3 rapZ RNase adapter protein RapZ Enterobacter sp. (strain 638)
C6DIN0 0.0 559 95 0 283 3 rapZ RNase adapter protein RapZ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6DAG8 0.0 559 95 0 283 3 rapZ RNase adapter protein RapZ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MJD4 0.0 559 95 0 283 3 rapZ RNase adapter protein RapZ Cronobacter sakazakii (strain ATCC BAA-894)
B7LR72 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1JKK0 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665I8 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THG8 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pestis (strain Pestoides F)
Q1CDY5 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1U0 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB41 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pestis
B2K419 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1J3 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDV3 0.0 558 95 0 283 3 rapZ RNase adapter protein RapZ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8AQ96 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YX36 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Shigella sonnei (strain Ss046)
P0A897 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Shigella flexneri
Q0T079 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Shigella flexneri serotype 5b (strain 8401)
Q31W81 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Shigella boydii serotype 4 (strain Sb227)
B2U1X2 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9MP02 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1R6C9 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain UTI89 / UPEC)
B1LGH1 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain SMS-3-5 / SECEC)
B6I1S8 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain SE11)
B7NDI9 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A894 0.0 558 94 0 283 1 rapZ RNase adapter protein RapZ Escherichia coli (strain K12)
B1IQR8 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A895 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCQ4 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A520 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O9:H4 (strain HS)
B1XHI0 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain K12 / DH10B)
C4ZSU4 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0S3 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O8 (strain IAI1)
B7N0J8 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O81 (strain ED1a)
B7NKS2 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YST8 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A896 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O157:H7
B7LHQ9 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli (strain 55989 / EAEC)
B7MBX4 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJU5 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSA4 0.0 558 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32BC8 0.0 557 94 0 283 3 rapZ RNase adapter protein RapZ Shigella dysenteriae serotype 1 (strain Sd197)
P17163 0.0 556 94 0 283 3 rapZ RNase adapter protein RapZ Klebsiella oxytoca
A1AGA6 0.0 556 94 0 283 3 rapZ RNase adapter protein RapZ Escherichia coli O1:K1 / APEC
A6TEM4 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XST6 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Klebsiella pneumoniae (strain 342)
Q8ZLR8 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWH5 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella schwarzengrund (strain CVM19633)
B5BGM9 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella paratyphi A (strain AKU_12601)
C0PZL8 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella paratyphi C (strain RKS4594)
A9N773 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLD3 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T736 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella newport (strain SL254)
B4TJP8 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella heidelberg (strain SL476)
B5RES1 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0J6 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella enteritidis PT4 (strain P125109)
B5FIQ3 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella dublin (strain CT_02021853)
Q57JE5 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella choleraesuis (strain SC-B67)
B5F6X4 0.0 555 94 0 283 3 rapZ RNase adapter protein RapZ Salmonella agona (strain SL483)
B2VGV3 0.0 554 95 0 283 3 rapZ RNase adapter protein RapZ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8Z3G1 0.0 553 93 0 283 3 rapZ RNase adapter protein RapZ Salmonella typhi
C5B725 0.0 548 93 0 283 3 rapZ RNase adapter protein RapZ Edwardsiella ictaluri (strain 93-146)
Q9ZA87 0.0 540 94 1 284 3 rapZ RNase adapter protein RapZ Proteus mirabilis (strain HI4320)
Q2NWK4 0.0 539 90 0 283 3 rapZ RNase adapter protein RapZ Sodalis glossinidius (strain morsitans)
C4K7I7 3.81e-169 472 79 0 283 3 rapZ RNase adapter protein RapZ Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0BT84 1.06e-146 415 69 1 282 3 APJL_0350 Nucleotide-binding protein APJL_0350 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MZ52 1.06e-146 415 69 1 282 3 APL_0334 Nucleotide-binding protein APL_0334 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H0H9 1.2e-146 415 69 1 282 3 APP7_0339 Nucleotide-binding protein APP7_0339 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65RT5 7.76e-144 408 66 1 282 3 MS1718 Nucleotide-binding protein MS1718 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CP85 3.08e-140 399 63 0 283 3 PM0169 Nucleotide-binding protein PM0169 Pasteurella multocida (strain Pm70)
B0UV71 1.11e-138 395 62 0 281 3 HSM_1595 Nucleotide-binding protein HSM_1595 Histophilus somni (strain 2336)
Q0I3W8 1.11e-138 395 62 0 281 3 HS_1178 Nucleotide-binding protein HS_1178 Histophilus somni (strain 129Pt)
A6VMV1 3.37e-138 394 63 1 285 3 Asuc_0930 Nucleotide-binding protein Asuc_0930 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45071 8.59e-138 393 62 0 283 3 HI_1146 Nucleotide-binding protein HI_1146 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UCW1 2.6e-137 393 62 0 283 3 CGSHiEE_06315 Nucleotide-binding protein CGSHiEE_06315 Haemophilus influenzae (strain PittEE)
Q4QLF0 3.76e-137 391 63 0 283 3 NTHI1314 Nucleotide-binding protein NTHI1314 Haemophilus influenzae (strain 86-028NP)
Q9L7V3 3.18e-135 386 65 1 282 3 HD_0584 Nucleotide-binding protein HD_0584 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LMB3 1.02e-133 382 61 0 282 3 PBPRA3258 Nucleotide-binding protein PBPRA3258 Photobacterium profundum (strain SS9)
B8F389 8.9e-133 380 64 0 281 3 HAPS_0087 Nucleotide-binding protein HAPS_0087 Glaesserella parasuis serovar 5 (strain SH0165)
B6EM99 3.53e-126 363 57 1 283 3 VSAL_I0495 Nucleotide-binding protein VSAL_I0495 Aliivibrio salmonicida (strain LFI1238)
Q5E7W7 6.17e-126 363 57 1 283 3 VF_0384 Nucleotide-binding protein VF_0384 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9M8 6.17e-126 363 57 1 283 3 VFMJ11_0375 Nucleotide-binding protein VFMJ11_0375 Aliivibrio fischeri (strain MJ11)
A0KQ08 9.46e-123 355 59 1 283 3 AHA_3920 Nucleotide-binding protein AHA_3920 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHY0 1.03e-122 355 59 1 283 3 ASA_0318 Nucleotide-binding protein ASA_0318 Aeromonas salmonicida (strain A449)
Q15YD8 1.22e-122 354 58 0 281 3 Patl_0571 Nucleotide-binding protein Patl_0571 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q87LD9 1.6e-122 354 56 1 283 3 VP2673 Nucleotide-binding protein VP2673 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5F5A9 3.91e-122 353 55 1 285 3 VC0395_A2112 Nucleotide-binding protein VC0395_A2112/VC395_2645 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LRJ5 3.91e-122 353 55 1 285 3 VCM66_2453 Nucleotide-binding protein VCM66_2453 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP47 5.67e-122 353 55 1 285 3 VC_2532 Nucleotide-binding protein VC_2532 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3IG30 1.01e-121 352 57 0 281 3 PSHAa2554 Nucleotide-binding protein PSHAa2554 Pseudoalteromonas translucida (strain TAC 125)
C4LCZ9 1.64e-121 352 60 1 283 3 Tola_2941 Nucleotide-binding protein Tola_2941 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4RWG2 8.73e-119 344 57 0 281 3 MADE_1004170 Nucleotide-binding protein MADE_1004170 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8DEA0 1.09e-118 344 56 1 284 3 VV1_0695 Nucleotide-binding protein VV1_0695 Vibrio vulnificus (strain CMCP6)
Q7MPB9 1.09e-118 344 56 1 284 3 VV0445 Nucleotide-binding protein VV0445 Vibrio vulnificus (strain YJ016)
B7VKV7 3.07e-118 343 55 2 287 3 VS_2760 Nucleotide-binding protein VS_2760 Vibrio atlanticus (strain LGP32)
Q47VH8 4.78e-118 343 56 0 280 3 CPS_4546 Nucleotide-binding protein CPS_4546 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SA87 6.55e-118 342 55 0 282 3 Sama_3091 Nucleotide-binding protein Sama_3091 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HMG7 2.55e-116 338 56 0 283 3 Shewmr4_0670 Nucleotide-binding protein Shewmr4_0670 Shewanella sp. (strain MR-4)
Q0HRC1 1.26e-115 337 56 0 283 3 Shewmr7_3352 Nucleotide-binding protein Shewmr7_3352 Shewanella sp. (strain MR-7)
A0KSY8 1.45e-115 336 56 0 283 3 Shewana3_0669 Nucleotide-binding protein Shewana3_0669 Shewanella sp. (strain ANA-3)
Q8EAE2 1.45e-115 336 56 0 283 3 SO_3964 Nucleotide-binding protein SO_3964 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KIQ6 1.72e-114 334 54 1 283 3 VIBHAR_03667 Nucleotide-binding protein VIBHAR_03667 Vibrio campbellii (strain ATCC BAA-1116)
A3D8T3 1.53e-112 328 56 0 283 3 Sbal_3671 Nucleotide-binding protein Sbal_3671 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9K8 2.2e-112 328 56 0 283 3 Sbal223_0704 Nucleotide-binding protein Sbal223_0704 Shewanella baltica (strain OS223)
A6WJ51 2.2e-112 328 56 0 283 3 Shew185_0683 Nucleotide-binding protein Shew185_0683 Shewanella baltica (strain OS185)
A4Y3A9 2.59e-112 328 55 0 283 3 Sputcn32_0712 Nucleotide-binding protein Sputcn32_0712 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RNM8 4.23e-112 328 55 0 283 3 Sputw3181_3461 Nucleotide-binding protein Sputw3181_3461 Shewanella sp. (strain W3-18-1)
Q5R0I2 6.76e-112 327 52 0 280 3 IL0393 Nucleotide-binding protein IL0393 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L0Z2 6.92e-112 327 55 0 283 3 Sbal195_0713 Nucleotide-binding protein Sbal195_0713 Shewanella baltica (strain OS195)
Q9S0K9 7.08e-111 324 54 0 279 3 None Nucleotide-binding protein in ptsN-ptsO intergenic region Shewanella violacea
A3QI82 5.4e-110 322 54 0 280 3 Shew_3314 Nucleotide-binding protein Shew_3314 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KIK3 1.93e-109 321 55 1 279 3 Swoo_4243 Nucleotide-binding protein Swoo_4243 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FR61 6.66e-109 319 54 0 279 3 Ssed_0723 Nucleotide-binding protein Ssed_0723 Shewanella sediminis (strain HAW-EB3)
Q07XP8 7.64e-109 319 54 1 280 3 Sfri_3380 Nucleotide-binding protein Sfri_3380 Shewanella frigidimarina (strain NCIMB 400)
B8CIL6 1.97e-108 318 53 0 283 3 swp_0674 Nucleotide-binding protein swp_0674 Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TUY1 4.42e-108 317 53 0 281 3 Shal_3708 Nucleotide-binding protein Shal_3708 Shewanella halifaxensis (strain HAW-EB4)
Q12RZ8 5.26e-108 317 54 0 279 3 Sden_0486 Nucleotide-binding protein Sden_0486 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1U474 5.82e-99 295 50 2 285 3 Maqu_2718 Nucleotide-binding protein Maqu_2718 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B3PBZ8 6.93e-99 295 49 2 287 3 CJA_2809 Nucleotide-binding protein CJA_2809 Cellvibrio japonicus (strain Ueda107)
A1SYN3 1.49e-97 290 50 1 282 3 Ping_2894 Nucleotide-binding protein Ping_2894 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q2SBH8 7.77e-97 289 47 2 286 3 HCH_05324 Nucleotide-binding protein HCH_05324 Hahella chejuensis (strain KCTC 2396)
C1DQ50 3.27e-94 282 51 4 287 3 Avin_12760 Nucleotide-binding protein Avin_12760 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q0VS51 8.52e-94 281 50 3 283 3 ABO_0549 Nucleotide-binding protein ABO_0549 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0KQH8 2e-93 280 50 4 287 3 PputGB1_0956 Nucleotide-binding protein PputGB1_0956 Pseudomonas putida (strain GB-1)
Q1H521 6.76e-93 279 51 5 282 3 Mfla_0145 Nucleotide-binding protein Mfla_0145 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A5VZ39 8.51e-93 278 50 4 287 3 Pput_0988 Nucleotide-binding protein Pput_0988 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4KI90 1.5e-92 278 50 4 287 3 PFL_0912 Nucleotide-binding protein PFL_0912 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88PA1 2.01e-92 278 50 4 287 3 PP_0949 Nucleotide-binding protein PP_0949 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1IEB5 2.17e-92 278 50 4 287 3 PSEEN1090 Nucleotide-binding protein PSEEN1090 Pseudomonas entomophila (strain L48)
Q21FU1 5.92e-92 276 45 2 287 3 Sde_3181 Nucleotide-binding protein Sde_3181 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3KI09 6.25e-92 276 50 4 287 3 Pfl01_0854 Nucleotide-binding protein Pfl01_0854 Pseudomonas fluorescens (strain Pf0-1)
Q9Z427 6.46e-92 276 50 4 287 3 None Nucleotide-binding protein in ptsO 5'region Pseudomonas putida
C3K839 1.03e-91 276 50 3 284 3 PFLU_0879 Nucleotide-binding protein PFLU_0879 Pseudomonas fluorescens (strain SBW25)
Q0A6G2 1.4e-91 276 50 5 287 3 Mlg_2233 Nucleotide-binding protein Mlg_2233 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B1JDM3 4.65e-91 274 50 4 287 3 PputW619_4266 Nucleotide-binding protein PputW619_4266 Pseudomonas putida (strain W619)
Q87WT7 7.11e-91 274 49 3 287 3 PSPTO_4456 Nucleotide-binding protein PSPTO_4456 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q02GX6 9.03e-91 273 50 3 284 3 PA14_57970 Nucleotide-binding protein PA14_57970 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V004 9.03e-91 273 50 3 284 3 PLES_48441 Nucleotide-binding protein PLES_48441 Pseudomonas aeruginosa (strain LESB58)
Q9HVV3 9.03e-91 273 50 3 284 3 PA4465 Nucleotide-binding protein PA4465 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VBD9 1.28e-90 273 50 3 284 3 PSPA7_5038 Nucleotide-binding protein PSPA7_5038 Pseudomonas aeruginosa (strain PA7)
Q8KLV8 2.66e-90 272 50 4 287 3 None Nucleotide-binding protein in ptsN-ptsO intergenic region Stutzerimonas stutzeri
A4VIC4 2.66e-90 272 50 4 287 3 PST_1028 Nucleotide-binding protein PST_1028 Stutzerimonas stutzeri (strain A1501)
B8GMI2 3.34e-90 272 48 3 285 3 Tgr7_0722 Nucleotide-binding protein Tgr7_0722 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1WYY2 5.16e-90 271 50 3 282 3 Hhal_2130 Nucleotide-binding protein Hhal_2130 Halorhodospira halophila (strain DSM 244 / SL1)
A4XQL9 5.45e-90 271 49 4 287 3 Pmen_0867 Nucleotide-binding protein Pmen_0867 Pseudomonas mendocina (strain ymp)
Q48EB2 7.4e-90 271 49 3 287 3 PSPPH_4154 Nucleotide-binding protein PSPPH_4154 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZNU2 2.56e-89 270 49 3 287 3 Psyr_4150 Nucleotide-binding protein Psyr_4150 Pseudomonas syringae pv. syringae (strain B728a)
Q3J7F2 9.17e-89 268 47 3 282 3 Noc_2797 Nucleotide-binding protein Noc_2797 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C5BSX6 8.17e-88 266 46 2 283 3 TERTU_3824 Nucleotide-binding protein TERTU_3824 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q1QVC8 1.43e-86 263 47 4 287 3 Csal_2229 Nucleotide-binding protein Csal_2229 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q60AV5 8.99e-86 261 47 3 284 3 MCA0739 Nucleotide-binding protein MCA0739 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8PIC2 3.12e-84 257 47 4 280 3 XAC2976 Nucleotide-binding protein XAC2976 Xanthomonas axonopodis pv. citri (strain 306)
Q3BQW0 6.32e-84 256 47 4 280 3 XCV3122 Nucleotide-binding protein XCV3122 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8Y2D3 1.54e-83 255 48 6 296 3 RSc0403 Nucleotide-binding protein RSc0403 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1LRP3 7.01e-83 254 47 7 302 3 Rmet_0297 Nucleotide-binding protein Rmet_0297 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2SJZ8 8.34e-83 253 47 4 280 3 PXO_02223 Nucleotide-binding protein PXO_02223 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5H3D7 8.34e-83 253 47 4 280 3 XOO1280 Nucleotide-binding protein XOO1280 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P693 8.34e-83 253 47 4 280 3 XOO1179 Nucleotide-binding protein XOO1179 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P708 2.37e-82 252 47 4 280 3 XCC2806 Nucleotide-binding protein XCC2806 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RQG9 2.37e-82 252 47 4 280 3 xcc-b100_1354 Nucleotide-binding protein xcc-b100_1354 Xanthomonas campestris pv. campestris (strain B100)
Q4UX47 2.37e-82 252 47 4 280 3 XC_1307 Nucleotide-binding protein XC_1307 Xanthomonas campestris pv. campestris (strain 8004)
B2UES4 3.95e-82 252 47 6 297 3 Rpic_0258 Nucleotide-binding protein Rpic_0258 Ralstonia pickettii (strain 12J)
Q5P3C8 5.68e-82 251 48 5 289 3 AZOSEA20610 Nucleotide-binding protein AZOSEA20610 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2I9L4 6.55e-82 251 45 3 285 3 XfasM23_0667 Nucleotide-binding protein XfasM23_0667 Xylella fastidiosa (strain M23)
Q87DP8 6.55e-82 251 45 3 285 3 PD_0634 Nucleotide-binding protein PD_0634 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U6M8 1.39e-81 250 45 3 285 3 Xfasm12_0753 Nucleotide-binding protein Xfasm12_0753 Xylella fastidiosa (strain M12)
Q7NST4 2.44e-81 249 48 8 290 3 CV_3336 Nucleotide-binding protein CV_3336 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q476F1 2.96e-81 249 48 6 294 3 Reut_A0350 Nucleotide-binding protein Reut_A0350 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B1XS59 3.67e-81 249 48 6 292 3 Pnec_1620 Nucleotide-binding protein Pnec_1620 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B2FRW0 4.1e-81 249 46 3 282 3 Smlt1108 Nucleotide-binding protein Smlt1108 Stenotrophomonas maltophilia (strain K279a)
Q9PDH4 4.39e-81 249 45 3 285 3 XF_1405 Nucleotide-binding protein XF_1405 Xylella fastidiosa (strain 9a5c)
Q2T1B0 1.28e-80 248 49 9 293 3 BTH_I0482 Nucleotide-binding protein BTH_I0482 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4T063 1.32e-80 248 47 7 295 3 Pnuc_1915 Nucleotide-binding protein Pnuc_1915 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1VKP5 2.07e-80 247 47 6 288 3 Pnap_0906 Nucleotide-binding protein Pnap_0906 Polaromonas naphthalenivorans (strain CJ2)
A2SL50 2.35e-80 248 46 5 290 3 Mpe_A3336 Nucleotide-binding protein Mpe_A3336 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B7J9Z4 2.51e-80 247 46 5 288 3 AFE_3021 Nucleotide-binding protein AFE_3021 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B5EQC6 2.51e-80 247 46 5 288 3 Lferr_2629 Nucleotide-binding protein Lferr_2629 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B2AGU6 1.15e-79 245 46 7 298 3 RALTA_A0325 Nucleotide-binding protein RALTA_A0325 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q47K02 1.38e-79 245 49 5 281 3 Daro_0070 Nucleotide-binding protein Daro_0070 Dechloromonas aromatica (strain RCB)
B4SMH8 2.37e-79 244 45 3 282 3 Smal_0950 Nucleotide-binding protein Smal_0950 Stenotrophomonas maltophilia (strain R551-3)
A9BP06 2.51e-79 245 46 8 289 3 Daci_5422 Nucleotide-binding protein Daci_5422 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6F856 4.55e-79 243 42 4 280 3 ACIAD3059 Nucleotide-binding protein ACIAD3059 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0KEP0 1.81e-78 243 46 7 301 3 H16_A0381 Nucleotide-binding protein H16_A0381 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0AFS9 1.94e-78 242 46 5 283 3 Neut_1559 Nucleotide-binding protein Neut_1559 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B7I684 2.43e-78 242 42 3 280 3 AB57_0691 Nucleotide-binding protein AB57_0691 Acinetobacter baumannii (strain AB0057)
B2HTG6 2.43e-78 242 42 3 280 3 ACICU_00591 Nucleotide-binding protein ACICU_00591 Acinetobacter baumannii (strain ACICU)
A3M295 2.43e-78 242 42 3 280 3 A1S_0588 Nucleotide-binding protein A1S_0588 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0V5P6 2.43e-78 242 42 3 280 3 ABAYE3173 Nucleotide-binding protein ABAYE3173 Acinetobacter baumannii (strain AYE)
B7H009 2.43e-78 242 42 3 280 3 ABBFA_002973 Nucleotide-binding protein ABBFA_002973 Acinetobacter baumannii (strain AB307-0294)
A3NRA4 2.78e-78 242 48 9 293 3 BURPS1106A_0593 Nucleotide-binding protein BURPS1106A_0593 Burkholderia pseudomallei (strain 1106a)
A3N5K8 2.78e-78 242 48 9 293 3 BURPS668_0577 Nucleotide-binding protein BURPS668_0577 Burkholderia pseudomallei (strain 668)
Q63XL1 2.78e-78 242 48 9 293 3 BPSL0529 Nucleotide-binding protein BPSL0529 Burkholderia pseudomallei (strain K96243)
B1JYP2 6.03e-78 241 48 8 290 3 Bcenmc03_2806 Nucleotide-binding protein Bcenmc03_2806 Burkholderia orbicola (strain MC0-3)
A0KAL8 6.03e-78 241 48 8 290 3 Bcen2424_2795 Nucleotide-binding protein Bcen2424_2795 Burkholderia cenocepacia (strain HI2424)
Q1BTH3 6.03e-78 241 48 8 290 3 Bcen_2181 Nucleotide-binding protein Bcen_2181 Burkholderia orbicola (strain AU 1054)
A9M393 1.47e-77 240 45 5 283 3 NMCC_0698 Nucleotide-binding protein NMCC_0698 Neisseria meningitidis serogroup C (strain 053442)
Q3JW79 1.8e-77 240 48 8 291 3 BURPS1710b_0761 Nucleotide-binding protein BURPS1710b_0761 Burkholderia pseudomallei (strain 1710b)
A3MQC2 1.8e-77 240 48 8 291 3 BMA10247_2938 Nucleotide-binding protein BMA10247_2938 Burkholderia mallei (strain NCTC 10247)
A2S6C3 1.8e-77 240 48 8 291 3 BMA10229_A1510 Nucleotide-binding protein BMA10229_A1510 Burkholderia mallei (strain NCTC 10229)
Q62FD0 1.8e-77 240 48 8 291 3 BMA3112 Nucleotide-binding protein BMA3112 Burkholderia mallei (strain ATCC 23344)
A1UZM9 1.8e-77 240 48 8 291 3 BMASAVP1_A0080 Nucleotide-binding protein BMASAVP1_A0080 Burkholderia mallei (strain SAVP1)
A1WGS2 2.47e-77 239 45 5 287 3 Veis_1053 Nucleotide-binding protein Veis_1053 Verminephrobacter eiseniae (strain EF01-2)
B4EAS0 2.61e-77 240 48 8 290 3 BceJ2315_08000 Nucleotide-binding protein BceJ2315_08000 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B0VKK2 3.05e-77 239 42 3 280 3 ABSDF2931 Nucleotide-binding protein ABSDF2931 Acinetobacter baumannii (strain SDF)
Q9K080 4.66e-77 238 44 5 283 3 NMB0738 Nucleotide-binding protein NMB0738 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B2SXH2 5.63e-77 239 47 8 290 3 Bphyt_0592 Nucleotide-binding protein Bphyt_0592 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q21XX0 6.04e-77 239 46 5 288 3 Rfer_1653 Nucleotide-binding protein Rfer_1653 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B9K7Z1 6.14e-77 238 40 3 280 3 CTN_0898 Nucleotide-binding protein CTN_0898 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B4RK03 6.25e-77 238 44 5 283 3 NGK_0463 Nucleotide-binding protein NGK_0463 Neisseria gonorrhoeae (strain NCCP11945)
Q5F9S5 6.25e-77 238 44 5 283 3 NGO0315 Nucleotide-binding protein NGO0315 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q12DZ2 1.53e-76 237 45 5 284 3 Bpro_1300 Nucleotide-binding protein Bpro_1300 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9AEZ5 2.53e-76 237 49 10 293 3 Bmul_0520 Nucleotide-binding protein Bmul_0520/BMULJ_02739 Burkholderia multivorans (strain ATCC 17616 / 249)
C5CYY8 3.26e-76 236 46 4 288 3 Vapar_4338 Nucleotide-binding protein Vapar_4338 Variovorax paradoxus (strain S110)
Q0BBR2 3.46e-76 237 49 9 291 3 Bamb_2855 Nucleotide-binding protein Bamb_2855 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YN45 3.46e-76 237 49 9 291 3 BamMC406_2713 Nucleotide-binding protein BamMC406_2713 Burkholderia ambifaria (strain MC40-6)
Q9JV90 3.52e-76 236 44 5 283 3 NMA0948 Nucleotide-binding protein NMA0948 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KT00 3.88e-76 236 44 5 283 3 NMC0691 Nucleotide-binding protein NMC0691 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A4JHY8 6.02e-76 236 48 10 293 3 Bcep1808_2900 Nucleotide-binding protein Bcep1808_2900 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q145W5 8.14e-76 236 47 8 290 3 Bxeno_A0336 Nucleotide-binding protein Bxeno_A0336 Paraburkholderia xenovorans (strain LB400)
Q82TN5 8.43e-76 235 45 5 285 3 NE1849 Nucleotide-binding protein NE1849 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2YCY1 1.2e-75 234 46 6 284 3 Nmul_A0081 Nucleotide-binding protein Nmul_A0081 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q39CU7 1.51e-75 235 47 8 290 3 Bcep18194_A6125 Nucleotide-binding protein Bcep18194_A6125 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2JCP6 1.61e-75 235 46 7 290 3 Bphy_0322 Nucleotide-binding protein Bphy_0322 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A5EVY7 2.69e-75 234 43 6 284 3 DNO_0399 Nucleotide-binding protein DNO_0399 Dichelobacter nodosus (strain VCS1703A)
A6T2R3 1.55e-74 232 44 5 290 3 mma_3120 Nucleotide-binding protein mma_3120 Janthinobacterium sp. (strain Marseille)
A4G912 2.73e-74 231 44 5 290 3 HEAR2885 Nucleotide-binding protein HEAR2885 Herminiimonas arsenicoxydans
A5WHC8 3.15e-74 232 43 5 269 3 PsycPRwf_2129 Nucleotide-binding protein PsycPRwf_2129 Psychrobacter sp. (strain PRwf-1)
B1Y3P1 4.47e-74 232 46 8 293 3 Lcho_3490 Nucleotide-binding protein Lcho_3490 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
C1D973 1.01e-73 230 44 5 286 3 LHK_02029 Nucleotide-binding protein LHK_02029 Laribacter hongkongensis (strain HLHK9)
B5YI18 5.8e-73 228 42 3 279 3 THEYE_A0235 Nucleotide-binding protein THEYE_A0235 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q3SLD3 6.96e-73 228 45 7 286 3 Tbd_0529 Nucleotide-binding protein Tbd_0529 Thiobacillus denitrificans (strain ATCC 25259)
B1LAX2 8.06e-73 228 41 3 280 3 TRQ2_1124 Nucleotide-binding protein TRQ2_1124 Thermotoga sp. (strain RQ2)
Q5WDJ0 9.14e-73 228 41 5 287 3 ABC3036 Nucleotide-binding protein ABC3036 Shouchella clausii (strain KSM-K16)
Q65EH0 9.99e-73 228 42 5 285 3 BLi03725 Nucleotide-binding protein BLi03725/BL03417 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9ME55 2.42e-72 226 45 6 288 3 Dtpsy_0831 Nucleotide-binding protein Dtpsy_0831 Acidovorax ebreus (strain TPSY)
B7IPR9 2.52e-72 227 41 5 289 3 BCG9842_B5683 Nucleotide-binding protein BCG9842_B5683 Bacillus cereus (strain G9842)
A7GUT7 2.52e-72 227 41 5 289 3 Bcer98_3698 Nucleotide-binding protein Bcer98_3698 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1W4G9 5.16e-72 226 45 6 288 3 Ajs_0902 Nucleotide-binding protein Ajs_0902 Acidovorax sp. (strain JS42)
B8F9W2 6.28e-72 226 44 5 284 3 Dalk_1358 Nucleotide-binding protein Dalk_1358 Desulfatibacillum aliphaticivorans
B7HW83 7.88e-72 225 42 6 289 3 BCAH187_A5316 Nucleotide-binding protein BCAH187_A5316 Bacillus cereus (strain AH187)
Q72XW4 7.88e-72 225 42 6 289 3 BCE_5259 Nucleotide-binding protein BCE_5259 Bacillus cereus (strain ATCC 10987 / NRS 248)
B9J4Q9 7.88e-72 225 42 6 289 3 BCQ_4976 Nucleotide-binding protein BCQ_4976 Bacillus cereus (strain Q1)
B7HEF6 1.13e-71 225 41 5 289 3 BCB4264_A5274 Nucleotide-binding protein BCB4264_A5274 Bacillus cereus (strain B4264)
Q815J4 1.13e-71 225 41 5 289 3 BC_5156 Nucleotide-binding protein BC_5156 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9M9R6 1.2e-71 225 41 5 286 3 Geob_2284 Nucleotide-binding protein Geob_2284 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q1QEJ2 1.76e-71 225 40 5 293 3 Pcryo_0127 Nucleotide-binding protein Pcryo_0127 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A7Z953 2.35e-71 224 42 6 288 3 RBAM_031990 Nucleotide-binding protein RBAM_031990 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5ILF1 2.66e-71 224 40 3 280 3 Tpet_1006 Nucleotide-binding protein Tpet_1006 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
C1F1L8 4.88e-71 224 40 4 282 3 ACP_0619 Nucleotide-binding protein ACP_0619 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A9VQ69 4.98e-71 223 41 5 289 3 BcerKBAB4_4948 Nucleotide-binding protein BcerKBAB4_4948 Bacillus mycoides (strain KBAB4)
Q5KVD5 5.32e-71 223 43 5 286 3 GK3066 Nucleotide-binding protein GK3066 Geobacillus kaustophilus (strain HTA426)
C3LEC4 8.29e-71 223 41 5 289 3 BAMEG_5437 Nucleotide-binding protein BAMEG_5437 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P0C2 8.29e-71 223 41 5 289 3 BAA_5414 Nucleotide-binding protein BAA_5414 Bacillus anthracis (strain A0248)
Q81X59 8.29e-71 223 41 5 289 3 BA_5384 Nucleotide-binding protein BA_5384/GBAA_5384/BAS5004 Bacillus anthracis
C1EZD6 8.29e-71 223 41 5 289 3 BCA_5283 Nucleotide-binding protein BCA_5283 Bacillus cereus (strain 03BB102)
B7JFI2 8.29e-71 223 41 5 289 3 BCAH820_5240 Nucleotide-binding protein BCAH820_5240 Bacillus cereus (strain AH820)
Q631J8 8.29e-71 223 41 5 289 3 BCE33L4848 Nucleotide-binding protein BCE33L4848 Bacillus cereus (strain ZK / E33L)
Q6HBD4 8.29e-71 223 41 5 289 3 BT9727_4833 Nucleotide-binding protein BT9727_4833 Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0RKU2 8.29e-71 223 41 5 289 3 BALH_4646 Nucleotide-binding protein BALH_4646 Bacillus thuringiensis (strain Al Hakam)
Q9K705 9.4e-71 223 42 5 288 3 BH3569 Nucleotide-binding protein BH3569 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C0Z6P0 1.02e-70 223 43 6 288 3 BBR47_52620 Nucleotide-binding protein BBR47_52620 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B7GL38 1.02e-70 223 42 5 289 3 Aflv_2526 Nucleotide-binding protein Aflv_2526 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q39W52 2.1e-70 221 41 5 286 3 Gmet_1286 Nucleotide-binding protein Gmet_1286 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4ISQ6 3.05e-70 221 43 5 286 3 GTNG_3015 Nucleotide-binding protein GTNG_3015 Geobacillus thermodenitrificans (strain NG80-2)
A5G5S2 5.9e-70 221 40 5 286 3 Gura_2968 Nucleotide-binding protein Gura_2968 Geotalea uraniireducens (strain Rf4)
Q7W014 6.34e-70 221 45 6 285 3 BP0690 Nucleotide-binding protein BP0690 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WEX0 6.34e-70 221 45 6 285 3 BB4511 Nucleotide-binding protein BB4511 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3J5 6.34e-70 221 45 6 285 3 BPP4038 Nucleotide-binding protein BPP4038 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
C6E4W6 6.81e-70 220 41 4 287 3 GM21_3387 Nucleotide-binding protein GM21_3387 Geobacter sp. (strain M21)
B2KAZ5 1.21e-69 219 41 6 285 3 Emin_0125 Nucleotide-binding protein Emin_0125 Elusimicrobium minutum (strain Pei191)
A7H6M4 1.24e-69 220 42 3 285 3 Anae109_0152 Nucleotide-binding protein Anae109_0152 Anaeromyxobacter sp. (strain Fw109-5)
Q4FVG6 1.56e-69 221 40 5 291 3 Psyc_0118 Nucleotide-binding protein Psyc_0118 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1TT66 3.19e-69 219 43 4 285 3 Aave_3603 Nucleotide-binding protein Aave_3603 Paracidovorax citrulli (strain AAC00-1)
Q01PW6 3.4e-69 219 39 4 282 3 Acid_7395 Nucleotide-binding protein Acid_7395 Solibacter usitatus (strain Ellin6076)
B5EEZ9 3.5e-69 218 41 4 287 3 Gbem_0872 Nucleotide-binding protein Gbem_0872 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A1K2G1 4.16e-69 218 45 6 287 3 azo0399 Nucleotide-binding protein azo0399 Azoarcus sp. (strain BH72)
A8FHQ2 4.92e-69 218 40 5 288 3 BPUM_3115 Nucleotide-binding protein BPUM_3115 Bacillus pumilus (strain SAFR-032)
A9I0N5 5.79e-69 218 45 6 285 3 Bpet0443 Nucleotide-binding protein Bpet0443 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A7HM73 1.4e-68 217 40 2 280 3 Fnod_1159 Nucleotide-binding protein Fnod_1159 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q88YI4 1.73e-68 217 40 5 285 3 lp_0779 Nucleotide-binding protein lp_0779 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q74BZ3 4.84e-68 216 40 5 286 3 GSU1884 Nucleotide-binding protein GSU1884 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1B5Z0 1.09e-67 216 41 4 284 3 Pden_2850 Nucleotide-binding protein Pden_2850 Paracoccus denitrificans (strain Pd 1222)
Q8ENL3 1.25e-67 215 41 6 286 3 OB2468 Nucleotide-binding protein OB2468 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q72BK4 1.54e-67 215 41 4 285 3 DVU_1631 Nucleotide-binding protein DVU_1631 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1VDK3 1.54e-67 215 41 4 285 3 Dvul_1502 Nucleotide-binding protein Dvul_1502 Nitratidesulfovibrio vulgaris (strain DP4)
B1I0X4 1.67e-67 214 41 5 287 3 Daud_0300 Nucleotide-binding protein Daud_0300 Desulforudis audaxviator (strain MP104C)
Q1IK18 2.02e-67 214 40 5 287 3 Acid345_3782 Nucleotide-binding protein Acid345_3782 Koribacter versatilis (strain Ellin345)
O06973 2.09e-67 214 42 6 288 1 yvcJ Nucleotide-binding protein YvcJ Bacillus subtilis (strain 168)
B8J8S6 2.54e-67 214 42 3 285 3 A2cp1_0165 Nucleotide-binding protein A2cp1_0165 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B4ULF0 2.54e-67 214 42 3 285 3 AnaeK_0154 Nucleotide-binding protein AnaeK_0154 Anaeromyxobacter sp. (strain K)
Q67T22 3.8e-67 214 42 5 284 3 STH186 Nucleotide-binding protein STH186 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2IM96 4.56e-67 213 42 3 285 3 Adeh_0147 Nucleotide-binding protein Adeh_0147 Anaeromyxobacter dehalogenans (strain 2CP-C)
A1A1N5 1.13e-66 213 41 5 287 3 BAD_0837 Nucleotide-binding protein BAD_0837 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A0ALF8 1.31e-66 212 40 5 285 3 lwe2422 Nucleotide-binding protein lwe2422 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q2KU92 1.73e-66 212 44 9 288 3 BAV3158 Nucleotide-binding protein BAV3158 Bordetella avium (strain 197N)
A4XIN0 2.4e-66 211 41 5 284 3 Csac_1160 Nucleotide-binding protein Csac_1160 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B8DBN7 2.96e-66 211 40 5 285 3 LMHCC_0126 Nucleotide-binding protein LMHCC_0126 Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y4G9 3.68e-66 211 40 5 285 3 lmo2474 Nucleotide-binding protein lmo2474 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WV3 3.76e-66 211 40 5 285 3 LMOf2365_2447 Nucleotide-binding protein LMOf2365_2447 Listeria monocytogenes serotype 4b (strain F2365)
C1KYP1 3.76e-66 211 40 5 285 3 Lm4b_02443 Nucleotide-binding protein Lm4b_02443 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8CTE3 4.99e-66 211 40 4 281 3 SE_0548 Nucleotide-binding protein SE_0548 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q47NB6 5.51e-66 211 39 3 283 3 Tfu_2020 Nucleotide-binding protein Tfu_2020 Thermobifida fusca (strain YX)
Q928B9 6.18e-66 210 40 5 285 3 lin2617 Nucleotide-binding protein lin2617 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B3DRV7 6.27e-66 211 41 5 291 3 BLD_0430 Nucleotide-binding protein BLD_0430 Bifidobacterium longum (strain DJO10A)
Q8G6D8 7.78e-66 211 41 5 291 3 BL0705 Nucleotide-binding protein BL0705 Bifidobacterium longum (strain NCC 2705)
B8DJQ9 8.24e-66 210 40 5 287 3 DvMF_0424 Nucleotide-binding protein DvMF_0424 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q310S5 9.56e-66 210 41 4 285 3 Dde_1774 Nucleotide-binding protein Dde_1774 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B8DUH4 1.13e-65 210 40 5 287 3 BLA_1368 Nucleotide-binding protein BLA_1368 Bifidobacterium animalis subsp. lactis (strain AD011)
B8IZF2 1.58e-65 210 40 4 287 3 Ddes_0972 Nucleotide-binding protein Ddes_0972 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q5HQW3 2.61e-65 209 39 4 281 3 SERP0433 Nucleotide-binding protein SERP0433 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B7GQU5 3.42e-65 209 41 5 291 3 Blon_1085 Nucleotide-binding protein Blon_1085/BLIJ_1109 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q2YSG2 3.72e-65 209 40 6 286 3 SAB0719 Nucleotide-binding protein SAB0719 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GIM6 3.76e-65 209 40 6 286 3 SAR0820 Nucleotide-binding protein SAR0820 Staphylococcus aureus (strain MRSA252)
Q5HHQ3 4.24e-65 209 40 6 286 3 SACOL0830 Nucleotide-binding protein SACOL0830 Staphylococcus aureus (strain COL)
A6TZP4 4.24e-65 209 40 6 286 3 SaurJH1_0806 Nucleotide-binding protein SaurJH1_0806 Staphylococcus aureus (strain JH1)
A8Z042 4.24e-65 209 40 6 286 3 USA300HOU_0794 Nucleotide-binding protein USA300HOU_0794 Staphylococcus aureus (strain USA300 / TCH1516)
A5IQW9 4.24e-65 209 40 6 286 3 SaurJH9_0790 Nucleotide-binding protein SaurJH9_0790 Staphylococcus aureus (strain JH9)
Q2G039 4.24e-65 209 40 6 286 3 SAOUHSC_00787 Nucleotide-binding protein SAOUHSC_00787 Staphylococcus aureus (strain NCTC 8325 / PS 47)
P67108 4.24e-65 209 40 6 286 3 SAV0765 Nucleotide-binding protein SAV0765 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WZR5 4.24e-65 209 40 6 286 3 SAHV_0762 Nucleotide-binding protein SAHV_0762 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2FIM8 4.24e-65 209 40 6 286 3 SAUSA300_0748 Nucleotide-binding protein SAUSA300_0748 Staphylococcus aureus (strain USA300)
A6QF73 4.24e-65 209 40 6 286 3 NWMN_0733 Nucleotide-binding protein NWMN_0733 Staphylococcus aureus (strain Newman)
Q6GB65 4.24e-65 209 40 6 286 3 SAS0730 Nucleotide-binding protein SAS0730 Staphylococcus aureus (strain MSSA476)
P67110 4.24e-65 209 40 6 286 3 MW0727 Nucleotide-binding protein MW0727 Staphylococcus aureus (strain MW2)
P67109 4.24e-65 209 40 6 286 1 SA0720 Nucleotide-binding protein SA0720 Staphylococcus aureus (strain N315)
Q2RNQ3 4.53e-65 209 40 2 281 3 Rru_A3448 Nucleotide-binding protein Rru_A3448 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5N359 5.3e-65 208 40 4 287 3 CKL_3564 Nucleotide-binding protein CKL_3564 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DWV1 5.3e-65 208 40 4 287 3 CKR_3143 Nucleotide-binding protein CKR_3143 Clostridium kluyveri (strain NBRC 12016)
B1YLF0 5.66e-65 208 40 4 277 3 Exig_2405 Nucleotide-binding protein Exig_2405 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B8E2D1 7.16e-65 207 40 7 288 3 Dtur_1129 Nucleotide-binding protein Dtur_1129 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q829W7 7.29e-65 208 39 2 282 3 SAV_6292 Nucleotide-binding protein SAV_6292 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q837R5 8.49e-65 207 39 4 285 3 EF_0766 Nucleotide-binding protein EF_0766 Enterococcus faecalis (strain ATCC 700802 / V583)
A6WC59 1.17e-64 207 41 2 282 3 Krad_2934 Nucleotide-binding protein Krad_2934 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B9MN04 1.4e-64 207 40 5 285 3 Athe_0320 Nucleotide-binding protein Athe_0320 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A4J903 1.56e-64 207 38 5 286 3 Dred_3054 Nucleotide-binding protein Dred_3054 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A8F4K6 1.81e-64 206 38 7 282 3 Tlet_0523 Nucleotide-binding protein Tlet_0523 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q9Z513 2.42e-64 206 39 4 286 3 SCO1952 Nucleotide-binding protein SCO1952 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q1AUH2 2.48e-64 207 41 8 298 3 Rxyl_2009 Nucleotide-binding protein Rxyl_2009 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q97LP3 2.57e-64 206 36 3 286 3 CA_C0511 Nucleotide-binding protein CA_C0511 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B5YE93 2.92e-64 206 38 6 290 3 DICTH_1001 Nucleotide-binding protein DICTH_1001 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B8CYG8 3.5e-64 206 39 4 286 3 Hore_15880 Nucleotide-binding protein Hore_15880 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B6IVB4 4.48e-64 207 42 4 283 3 RC1_2868 Nucleotide-binding protein RC1_2868 Rhodospirillum centenum (strain ATCC 51521 / SW)
A7FYX1 4.7e-64 206 38 4 285 3 CLB_3433 Nucleotide-binding protein CLB_3433 Clostridium botulinum (strain ATCC 19397 / Type A)
A5I7A2 4.7e-64 206 38 4 285 3 CBO3377 Nucleotide-binding protein CBO3377/CLC_3320 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
B2A700 5.11e-64 206 37 4 285 3 Nther_2024 Nucleotide-binding protein Nther_2024 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q2RLU6 5.51e-64 206 43 5 282 3 Moth_0258 Nucleotide-binding protein Moth_0258 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B7ID82 6.85e-64 204 39 3 268 3 THA_1518 Nucleotide-binding protein THA_1518 Thermosipho africanus (strain TCF52B)
C1FM59 7.33e-64 205 38 4 285 3 CLM_3839 Nucleotide-binding protein CLM_3839 Clostridium botulinum (strain Kyoto / Type A2)
A7GIX3 7.33e-64 205 38 4 285 3 CLI_3561 Nucleotide-binding protein CLI_3561 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IFW3 7.33e-64 205 38 4 285 3 CLD_1131 Nucleotide-binding protein CLD_1131 Clostridium botulinum (strain Okra / Type B1)
A0LJZ7 8.72e-64 204 40 6 288 3 Sfum_2066 Nucleotide-binding protein Sfum_2066 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A9WT68 9.05e-64 205 41 5 286 3 RSal33209_2275 Nucleotide-binding protein RSal33209_2275 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q1CY37 1.31e-63 204 39 4 283 3 MXAN_6564 Nucleotide-binding protein MXAN_6564 Myxococcus xanthus (strain DK1622)
B3E458 1.52e-63 204 39 3 285 3 Glov_2163 Nucleotide-binding protein Glov_2163 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B0K7T0 2.22e-63 204 38 5 286 3 Teth39_0666 Nucleotide-binding protein Teth39_0666 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K6J6 2.22e-63 204 38 5 286 3 Teth514_1178 Nucleotide-binding protein Teth514_1178 Thermoanaerobacter sp. (strain X514)
B1L270 2.38e-63 204 37 4 285 3 CLK_2809 Nucleotide-binding protein CLK_2809 Clostridium botulinum (strain Loch Maree / Type A3)
B2HP73 3.98e-63 204 39 5 286 3 MMAR_2228 Nucleotide-binding protein MMAR_2228 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PPM2 3.98e-63 204 39 5 286 3 MUL_1815 Nucleotide-binding protein MUL_1815 Mycobacterium ulcerans (strain Agy99)
Q2VYX5 4.02e-63 204 39 2 282 3 amb4396 Nucleotide-binding protein amb4396 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8R8Z8 4.08e-63 203 37 5 286 3 TTE1834 Nucleotide-binding protein TTE1834 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C3KV10 4.66e-63 203 37 4 285 3 CLJ_B3680 Nucleotide-binding protein CLJ_B3680 Clostridium botulinum (strain 657 / Type Ba4)
Q03SM6 7.1e-63 202 39 7 292 3 LVIS_0651 Nucleotide-binding protein LVIS_0651 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q890Y7 7.1e-63 202 39 6 286 3 CTC_02495 Nucleotide-binding protein CTC_02495 Clostridium tetani (strain Massachusetts / E88)
A0PYB5 1.15e-62 202 38 4 285 3 NT01CX_1284 Nucleotide-binding protein NT01CX_1284 Clostridium novyi (strain NT)
Q3AFE0 1.2e-62 202 37 5 293 3 CHY_0272 Nucleotide-binding protein CHY_0272 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B0TGL0 1.27e-62 202 41 6 285 3 Helmi_06460 Nucleotide-binding protein Helmi_06460 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q74K87 1.39e-62 202 43 4 264 3 LJ_0866 Nucleotide-binding protein LJ_0866 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B1W0Y9 1.58e-62 203 39 5 289 3 SGR_5570 Nucleotide-binding protein SGR_5570 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q4L4J2 2.86e-62 201 38 5 284 3 SH2124 Nucleotide-binding protein SH2124 Staphylococcus haemolyticus (strain JCSC1435)
B2TQS1 5.42e-62 200 37 3 284 3 CLL_A3342 Nucleotide-binding protein CLL_A3342 Clostridium botulinum (strain Eklund 17B / Type B)
B2UZY3 5.42e-62 200 37 3 284 3 CLH_3092 Nucleotide-binding protein CLH_3092 Clostridium botulinum (strain Alaska E43 / Type E3)
C1C8F7 5.87e-62 200 38 6 287 3 SP70585_1607 Nucleotide-binding protein SP70585_1607 Streptococcus pneumoniae (strain 70585)
C1CLR5 5.87e-62 200 38 6 287 3 SPP_1589 Nucleotide-binding protein SPP_1589 Streptococcus pneumoniae (strain P1031)
Q97PN7 5.87e-62 200 38 6 287 3 SP_1566 Nucleotide-binding protein SP_1566 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CSI6 5.87e-62 200 38 6 287 3 SPT_1506 Nucleotide-binding protein SPT_1506 Streptococcus pneumoniae (strain Taiwan19F-14)
Q5FL58 6.6e-62 200 42 4 265 3 LBA0691 Nucleotide-binding protein LBA0691 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q2LSN7 6.83e-62 200 38 6 286 3 SYNAS_12170 Nucleotide-binding protein SYNAS_12170 Syntrophus aciditrophicus (strain SB)
A6LMR9 8.21e-62 199 38 4 280 3 Tmel_1373 Nucleotide-binding protein Tmel_1373 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A8AWT5 9.34e-62 200 39 6 289 3 SGO_0954 Nucleotide-binding protein SGO_0954 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A0LCX6 9.79e-62 200 36 4 294 3 Mmc1_3333 Nucleotide-binding protein Mmc1_3333 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q3A381 1.19e-61 199 41 5 284 3 Pcar_1935 Nucleotide-binding protein Pcar_1935 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q741E4 1.59e-61 199 39 4 285 3 MAP_1147 Nucleotide-binding protein MAP_1147 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A8LLE8 1.62e-61 199 41 8 289 3 Dshi_0209 Nucleotide-binding protein Dshi_0209 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A1T8K5 1.66e-61 200 39 4 285 3 Mvan_2698 Nucleotide-binding protein Mvan_2698 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8FT61 1.84e-61 199 40 7 285 3 CE1710 Nucleotide-binding protein CE1710 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1WT77 1.91e-61 199 39 4 284 3 LSL_1171 Nucleotide-binding protein LSL_1171 Ligilactobacillus salivarius (strain UCC118)
A0QI03 1.98e-61 199 38 4 285 3 MAV_3359 Nucleotide-binding protein MAV_3359 Mycobacterium avium (strain 104)
A5CRU0 2.23e-61 199 40 7 287 3 CMM_1747 Nucleotide-binding protein CMM_1747 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C0QJ67 2.24e-61 199 38 6 287 3 HRM2_27900 Nucleotide-binding protein HRM2_27900 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A5CYK7 2.32e-61 198 40 6 288 3 PTH_2729 Nucleotide-binding protein PTH_2729 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B1ICY6 2.78e-61 199 38 6 287 3 SPH_1680 Nucleotide-binding protein SPH_1680 Streptococcus pneumoniae (strain Hungary19A-6)
B8ZLS8 2.78e-61 199 38 6 287 3 SPN23F15830 Nucleotide-binding protein SPN23F15830 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B2IR84 2.78e-61 199 38 6 287 3 SPCG_1551 Nucleotide-binding protein SPCG_1551 Streptococcus pneumoniae (strain CGSP14)
B5E6K9 2.78e-61 199 38 6 287 3 SPG_1492 Nucleotide-binding protein SPG_1492 Streptococcus pneumoniae serotype 19F (strain G54)
A1KIL0 2.98e-61 199 39 5 286 3 BCG_1482 Nucleotide-binding protein BCG_1482 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
C1AN66 2.98e-61 199 39 5 286 3 JTY_1457 Nucleotide-binding protein JTY_1457 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
P67107 2.98e-61 199 39 5 286 3 BQ2027_MB1456 Nucleotide-binding protein Mb1456 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5U2C3 2.98e-61 199 39 5 286 3 MRA_1430 Nucleotide-binding protein MRA_1430 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WFQ3 2.98e-61 199 39 5 286 1 Rv1421 Nucleotide-binding protein Rv1421 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFQ2 2.98e-61 199 39 5 286 3 MT1464 Nucleotide-binding protein MT1464 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A8YUD6 3.12e-61 198 42 3 263 3 lhv_0732 Nucleotide-binding protein lhv_0732 Lactobacillus helveticus (strain DPC 4571)
Q042E5 3.18e-61 198 42 4 264 3 LGAS_1315 Nucleotide-binding protein LGAS_1315 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B8I4X3 4.26e-61 198 37 3 285 3 Ccel_2290 Nucleotide-binding protein Ccel_2290 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B0REJ6 5.69e-61 197 40 7 287 3 CMS1991 Nucleotide-binding protein CMS1991 Clavibacter sepedonicus
A1AMN5 6.17e-61 197 39 7 287 3 Ppro_0977 Nucleotide-binding protein Ppro_0977 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q49VW3 6.59e-61 198 39 4 281 3 SSP1952 Nucleotide-binding protein SSP1952 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C4ZEG8 6.64e-61 197 38 7 291 3 EUBREC_0697 Nucleotide-binding protein EUBREC_0697 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A4VTZ7 8.31e-61 197 38 6 287 3 SSU05_0620 Nucleotide-binding protein SSU05_0620 Streptococcus suis (strain 05ZYH33)
A4W088 8.31e-61 197 38 6 287 3 SSU98_0619 Nucleotide-binding protein SSU98_0619 Streptococcus suis (strain 98HAH33)
A1UFN3 8.37e-61 197 40 5 286 3 Mkms_2443 Nucleotide-binding protein Mkms_2443 Mycobacterium sp. (strain KMS)
A3PZ94 8.37e-61 197 40 5 286 3 Mjls_2437 Nucleotide-binding protein Mjls_2437 Mycobacterium sp. (strain JLS)
Q1B9D0 8.37e-61 197 40 5 286 3 Mmcs_2396 Nucleotide-binding protein Mmcs_2396 Mycobacterium sp. (strain MCS)
A5V3A1 9.23e-61 198 41 3 287 3 Swit_0399 Nucleotide-binding protein Swit_0399 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q8DP10 1.22e-60 197 37 6 287 3 spr1424 Nucleotide-binding protein spr1424 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JI2 1.22e-60 197 37 6 287 3 SPD_1396 Nucleotide-binding protein SPD_1396 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CFE9 1.82e-60 196 38 6 287 3 SPJ_1472 Nucleotide-binding protein SPJ_1472 Streptococcus pneumoniae (strain JJA)
A6M2Y3 2.56e-60 196 38 5 283 3 Cbei_4857 Nucleotide-binding protein Cbei_4857 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B8H7M0 2.75e-60 196 40 4 286 3 Achl_1824 Nucleotide-binding protein Achl_1824 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q5M058 2.96e-60 196 36 6 290 3 str0831 Nucleotide-binding protein str0831 Streptococcus thermophilus (strain CNRZ 1066)
Q03L10 3.03e-60 196 36 6 290 3 STER_0875 Nucleotide-binding protein STER_0875 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4R9 3.03e-60 196 36 6 290 3 stu0831 Nucleotide-binding protein stu0831 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
B9DRP5 3.6e-60 196 39 10 293 3 SUB0630 Nucleotide-binding protein SUB0630 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q2JCI2 3.68e-60 196 39 3 283 3 Francci3_1634 Nucleotide-binding protein Francci3_1634 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0JWP3 4.01e-60 196 40 4 286 3 Arth_2083 Nucleotide-binding protein Arth_2083 Arthrobacter sp. (strain FB24)
A9G7Z8 6.73e-60 197 40 6 290 3 sce5766 Nucleotide-binding protein sce5766 Sorangium cellulosum (strain So ce56)
A8KYR1 7.93e-60 194 39 3 283 3 Franean1_2060 Nucleotide-binding protein Franean1_2060 Parafrankia sp. (strain EAN1pec)
Q180P8 1.22e-59 194 38 5 282 3 CD630_34000 Nucleotide-binding protein CD630_34000 Clostridioides difficile (strain 630)
Q0B094 1.27e-59 194 39 5 287 3 Swol_0262 Nucleotide-binding protein Swol_0262 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A3CM36 1.27e-59 194 37 6 286 3 SSA_0810 Nucleotide-binding protein SSA_0810 Streptococcus sanguinis (strain SK36)
A4QEG5 1.48e-59 194 40 6 265 3 cgR_1639 Nucleotide-binding protein cgR_1639 Corynebacterium glutamicum (strain R)
Q8NQ56 1.48e-59 194 40 6 265 3 Cgl1591 Nucleotide-binding protein Cgl1591/cg1794 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B1HVQ6 1.59e-59 194 38 5 290 3 Bsph_0448 Nucleotide-binding protein Bsph_0448 Lysinibacillus sphaericus (strain C3-41)
Q5FSQ7 1.85e-59 194 41 2 260 3 GOX0815 Nucleotide-binding protein GOX0815 Gluconobacter oxydans (strain 621H)
Q1GB34 2.01e-59 194 42 4 264 3 Ldb0621 Nucleotide-binding protein Ldb0621 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04BI0 2.01e-59 194 42 4 264 3 LBUL_0556 Nucleotide-binding protein LBUL_0556 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q5LVI8 2.23e-59 193 38 3 280 3 SPO0713 Nucleotide-binding protein SPO0713 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9EAG2 2.37e-59 194 39 5 283 3 MCCL_0516 Nucleotide-binding protein MCCL_0516 Macrococcus caseolyticus (strain JCSC5402)
Q1GDU6 3.17e-59 193 38 5 284 3 TM1040_2438 Nucleotide-binding protein TM1040_2438 Ruegeria sp. (strain TM1040)
A8MLW9 4.04e-59 193 39 5 282 3 Clos_0574 Nucleotide-binding protein Clos_0574 Alkaliphilus oremlandii (strain OhILAs)
Q8XNH9 4.53e-59 193 37 4 287 3 CPE0354 Nucleotide-binding protein CPE0354 Clostridium perfringens (strain 13 / Type A)
Q0TU87 4.53e-59 193 37 4 287 3 CPF_0343 Nucleotide-binding protein CPF_0343 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SW36 4.53e-59 193 37 4 287 3 CPR_0335 Nucleotide-binding protein CPR_0335 Clostridium perfringens (strain SM101 / Type A)
Q9CCP0 5.24e-59 193 39 5 286 3 ML0563 Nucleotide-binding protein ML0563 Mycobacterium leprae (strain TN)
B8ZUN6 5.24e-59 193 39 5 286 3 MLBr00563 Nucleotide-binding protein MLBr00563 Mycobacterium leprae (strain Br4923)
Q38YA1 7.6e-59 192 37 5 285 3 LCA_0526 Nucleotide-binding protein LCA_0526 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0RH01 7.66e-59 192 38 3 283 3 FRAAL4592 Nucleotide-binding protein FRAAL4592 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A1R6G6 1.01e-58 192 40 6 290 3 AAur_2084 Nucleotide-binding protein AAur_2084 Paenarthrobacter aurescens (strain TC1)
Q1GRG3 2.25e-58 192 38 3 283 3 Sala_2050 Nucleotide-binding protein Sala_2050 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A6TVF5 2.3e-58 191 37 6 293 3 Amet_4092 Nucleotide-binding protein Amet_4092 Alkaliphilus metalliredigens (strain QYMF)
Q3K2E1 2.53e-58 191 39 9 290 3 SAK_0681 Nucleotide-binding protein SAK_0681 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P67111 2.53e-58 191 39 9 290 3 gbs0576 Nucleotide-binding protein gbs0576 Streptococcus agalactiae serotype III (strain NEM316)
P67112 2.53e-58 191 39 9 290 3 SAG0531 Nucleotide-binding protein SAG0531 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
A4TC20 3.39e-58 192 39 4 266 3 Mflv_3714 Nucleotide-binding protein Mflv_3714 Mycolicibacterium gilvum (strain PYR-GCK)
B9DJK9 4.05e-58 191 39 6 282 3 Sca_0414 Nucleotide-binding protein Sca_0414 Staphylococcus carnosus (strain TM300)
B1H084 4.34e-58 190 36 5 283 3 TGRD_433 Nucleotide-binding protein TGRD_433 Endomicrobium trichonymphae
A4WVN6 4.46e-58 191 39 5 283 3 Rsph17025_2562 Nucleotide-binding protein Rsph17025_2562 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q2NCS5 5.1e-58 190 37 3 284 3 ELI_02120 Nucleotide-binding protein ELI_02120 Erythrobacter litoralis (strain HTCC2594)
Q9CGY1 7.38e-58 190 36 5 286 3 yjiE Nucleotide-binding protein YjiE Lactococcus lactis subsp. lactis (strain IL1403)
A1SJP6 7.6e-58 190 38 7 292 3 Noca_2527 Nucleotide-binding protein Noca_2527 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q02ZN8 9.76e-58 189 36 5 286 3 LACR_1047 Nucleotide-binding protein LACR_1047 Lactococcus lactis subsp. cremoris (strain SK11)
Q6AF48 1.01e-57 189 40 7 287 3 Lxx11490 Nucleotide-binding protein Lxx11490 Leifsonia xyli subsp. xyli (strain CTCB07)
Q6A9J7 1.05e-57 189 38 4 282 3 PPA0813 Nucleotide-binding protein PPA0813 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A2RLG5 1.06e-57 189 36 5 286 3 llmg_1557 Nucleotide-binding protein llmg_1557 Lactococcus lactis subsp. cremoris (strain MG1363)
A9BFB6 1.42e-57 189 36 4 282 3 Pmob_0154 Nucleotide-binding protein Pmob_0154 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q16AH2 1.95e-57 189 38 3 283 3 RD1_1380 Nucleotide-binding protein RD1_1380 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B9KSB7 2.55e-57 188 38 5 283 3 RSKD131_3085 Nucleotide-binding protein RSKD131_3085 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5V2 2.98e-57 188 38 5 283 3 RHOS4_02640 Nucleotide-binding protein RHOS4_02640 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A8ZTP9 3.33e-57 188 39 7 293 3 Dole_0503 Nucleotide-binding protein Dole_0503 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A0QWV7 3.54e-57 188 38 5 286 3 MSMEG_3079 Nucleotide-binding protein MSMEG_3079/MSMEI_3001 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A5VII1 3.87e-57 187 39 8 290 3 Lreu_0386 Nucleotide-binding protein Lreu_0386 Limosilactobacillus reuteri (strain DSM 20016)
B2G609 3.87e-57 187 39 8 290 3 LAR_0375 Nucleotide-binding protein LAR_0375 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A3PGG7 3.94e-57 188 38 5 283 3 Rsph17029_0317 Nucleotide-binding protein Rsph17029_0317 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4FBM0 5.31e-57 187 38 5 287 3 SACE_2139 Nucleotide-binding protein SACE_2139 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A3DBM5 5.45e-57 187 35 6 289 3 Cthe_0113 Nucleotide-binding protein Cthe_0113 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8DTM7 5.58e-57 187 38 8 290 3 SMU_1306c Nucleotide-binding protein SMU_1306c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A4XDR7 6.89e-57 187 37 2 271 3 Strop_3101 Nucleotide-binding protein Strop_3101 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q0S0J8 7.29e-57 187 37 5 288 3 RHA1_ro07174 Nucleotide-binding protein RHA1_ro07174 Rhodococcus jostii (strain RHA1)
Q2G484 8.26e-57 187 38 4 290 3 Saro_2904 Nucleotide-binding protein Saro_2904 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q03AL4 9.92e-57 187 38 7 289 3 LSEI_0959 Nucleotide-binding protein LSEI_0959 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WCQ8 9.92e-57 187 38 7 289 3 LCABL_10730 Nucleotide-binding protein LCABL_10730 Lacticaseibacillus casei (strain BL23)
C1B4L3 1.32e-56 187 37 5 288 3 ROP_69550 Nucleotide-binding protein ROP_69550 Rhodococcus opacus (strain B4)
Q5NMW1 1.72e-56 187 37 3 285 3 ZMO1325 Nucleotide-binding protein ZMO1325 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q1MR63 1.89e-56 187 35 4 287 3 LI0459 Nucleotide-binding protein LI0459 Lawsonia intracellularis (strain PHE/MN1-00)
C0ZZE9 2.6e-56 186 38 4 268 3 RER_30260 Nucleotide-binding protein RER_30260 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
C3PG36 3.57e-56 185 39 7 284 3 cauri_1197 Nucleotide-binding protein cauri_1197 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B1MC91 8.07e-56 185 38 2 263 3 MAB_2783c Nucleotide-binding protein MAB_2783c Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q5YTQ0 1.21e-55 185 37 4 271 3 NFA_35930 Nucleotide-binding protein NFA_35930 Nocardia farcinica (strain IFM 10152)
A9KSS4 1.29e-55 184 37 6 290 3 Cphy_0331 Nucleotide-binding protein Cphy_0331 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A8LW22 2.77e-55 183 37 2 271 3 Sare_3328 Nucleotide-binding protein Sare_3328 Salinispora arenicola (strain CNS-205)
Q6NH32 2.9e-55 183 37 4 267 3 DIP1313 Nucleotide-binding protein DIP1313 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5XD19 8.72e-55 182 37 6 289 3 M6_Spy0559 Nucleotide-binding protein M6_Spy0559 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A0LTX3 9.15e-55 182 36 4 288 3 Acel_1111 Nucleotide-binding protein Acel_1111 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
C1D1U3 1.14e-54 181 40 7 293 3 Deide_09390 Nucleotide-binding protein Deide_09390 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q8REL1 1.17e-54 181 34 4 286 3 FN1089 Nucleotide-binding protein FN1089 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B2GH81 1.44e-54 181 39 6 290 3 KRH_12070 Nucleotide-binding protein KRH_12070 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
P67113 2.59e-54 181 37 6 289 3 SPy_0652 Nucleotide-binding protein SPy_0652/M5005_Spy0539 Streptococcus pyogenes serotype M1

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07595
Feature type CDS
Gene rapZ
Product RNase adapter RapZ
Location 193070 - 193921 (strand: -1)
Length 852 (nucleotides) / 283 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_738
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03668 RapZ-like N-terminal domain
PF22740 RapZ C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1660 Signal transduction mechanisms (T) T RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06958 RNase adapter protein RapZ - -

Protein Sequence

MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVTLLPELAATLATRDTSAAVSIDVRNMPESPEVFEEALTRLPDSFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEKRK

Flanking regions ( +/- flanking 50bp)

ACGGATAATGGCGTATTGCCATTGAAAGAGAAACGATAGGGAGTCCCCTCATGGTGCTGATGATTGTCAGCGGCCGCTCTGGTTCGGGTAAATCTGTTGCCCTGCGGGCGCTGGAAGATATGGGTTTCTACTGCGTTGATAACCTGCCGGTCACTCTTCTGCCGGAGCTTGCCGCTACCCTGGCAACACGCGATACCTCTGCCGCAGTAAGTATTGACGTCCGCAATATGCCGGAGTCTCCGGAGGTGTTTGAGGAAGCCCTGACCAGATTACCGGACAGTTTCTCACCCCAGCTGCTGTTCCTGGATGCGGATCGCAATACGCTGATCCGCCGTTACAGTGATACCCGCCGTCTGCATCCCCTTTCCAGTAAAAATCTCTCGCTGGAAAGCGCTATTGATGAGGAAAGCGATCTGCTGGAGCCGCTGCGCTCCCGTGCGGATCTGATTATCGATACCTCTGAAATGTCAGTGCATGAACTGGCAGAAATGCTGAGAACCCGTCTGCTCGGCAAACGCGAACGCGAGCTGACCATGGTATTCGAATCGTTCGGGTTTAAACACGGCATTCCGATTGATGCGGATTATGTGTTTGATGTCCGCTTCCTGCCGAACCCGCACTGGGATCCGAAACTGCGTCCGATGACCGGTCTGGATAAACCGGTGGCGGCGTTCCTCGACCGCCATACGGAAGTACATAACTTTATTTACCAGACCCGCAGTTATCTGGAACTGTGGCTGCCGATGCTGGAAACCAACAACCGCAGCTACCTGACCGTCGCTATCGGCTGTACCGGCGGGAAACACCGTTCTGTCTATGTGGCGGAGCAACTGGCGGATTACTTCCGCTCACGCGGGAAAAACGTGCAGTCGCGCCACCGGACACTGGAAAAGCGGAAATAATCCATGACTATCCGTTGTCAGGTTGAAATCAAAAACCGGCTGGGGCTGCA