Homologs in group_3230

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03660 FBDBKF_03660 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_06875 EHELCC_06875 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_06735 LHKJJB_06735 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_04195 HKOGLL_04195 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3230

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3230

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07200
Feature type CDS
Gene -
Product hypothetical protein
Location 110413 - 110523 (strand: 1)
Length 111 (nucleotides) / 36 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3230
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSAGSTPENDPRGDSDYDTPWKLQPDQQLQPGFVKD

Flanking regions ( +/- flanking 50bp)

AGCTGATAAGTACATCGATGGATGATAATTATGCTGTTCCGTAGGATGTTATGAGTGCGGGCAGTACACCGGAGAATGATCCGCGGGGAGACAGTGACTATGATACTCCGTGGAAATTGCAGCCGGATCAGCAATTACAGCCAGGATTCGTGAAAGACTGAACACACTGTAACGTCACAGGTCAGTCTGCCCGTAAAACCCGGGCGGACTG