Homologs in group_3247

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04915 FBDBKF_04915 100.0 Morganella morganii S1 arsD arsenite efflux transporter metallochaperone ArsD
EHELCC_06205 EHELCC_06205 100.0 Morganella morganii S2 arsD arsenite efflux transporter metallochaperone ArsD
LHKJJB_03405 LHKJJB_03405 100.0 Morganella morganii S3 arsD arsenite efflux transporter metallochaperone ArsD
HKOGLL_06880 HKOGLL_06880 100.0 Morganella morganii S5 arsD arsenite efflux transporter metallochaperone ArsD

Distribution of the homologs in the orthogroup group_3247

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3247

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P46003 4.84e-53 165 64 2 122 1 arsD Arsenical resistance operon trans-acting repressor ArsD Escherichia coli
P52148 8.36e-52 162 63 2 122 4 arsD Arsenical resistance operon trans-acting repressor ArsD Escherichia coli
O52028 3.36e-14 66 30 1 108 2 arsD Putative arsenical resistance operon repressor ArsD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06525
Feature type CDS
Gene arsD
Product arsenite efflux transporter metallochaperone ArsD
Location 292097 - 292462 (strand: -1)
Length 366 (nucleotides) / 121 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3247
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF06953 Arsenical resistance operon protein ArsD

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
arsD arsenite efflux transporter metallochaperone ArsD plus STRESS ARSENIC ARSENITE NF033727 

Protein Sequence

MKKLEVFDPALCCSTGVCGTEVDQALVDFATDMDWLKKQGASIRRFNLAQEPMEFVNNTKAKTFLETAGAGSLPLLILDGEIVLTGRYPKRHELARWFGIRPNIEKAEIVKSCCGNGKTCC

Flanking regions ( +/- flanking 50bp)

TAAAAATTTTTAAGCTAACATATTTGAAAAAACATATGTAAGGTTGAGCGATGAAAAAACTAGAAGTATTTGATCCAGCGTTATGCTGTAGCACCGGTGTTTGCGGAACCGAAGTCGATCAAGCATTGGTAGACTTCGCAACAGATATGGATTGGTTAAAAAAACAAGGAGCAAGTATAAGGCGTTTTAATTTAGCGCAAGAGCCTATGGAGTTCGTTAACAACACAAAAGCAAAAACATTTTTGGAAACCGCAGGTGCCGGGTCACTTCCGCTATTGATTCTTGACGGTGAGATTGTGCTGACTGGTCGATACCCAAAACGACATGAGCTCGCCAGATGGTTTGGTATTCGACCGAATATTGAAAAAGCTGAAATTGTTAAATCGTGTTGTGGTAATGGTAAAACGTGTTGTTAACAGGAGCAATAAAATGAAATTTTTAGATAACACACCTAATTATTTATTTT