Homologs in group_3145

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00220 FBDBKF_00220 100.0 Morganella morganii S1 - DUF551 domain-containing protein
EHELCC_01325 EHELCC_01325 100.0 Morganella morganii S2 - DUF551 domain-containing protein
LHKJJB_03650 LHKJJB_03650 100.0 Morganella morganii S3 - DUF551 domain-containing protein
HKOGLL_03395 HKOGLL_03395 100.0 Morganella morganii S5 - DUF551 domain-containing protein

Distribution of the homologs in the orthogroup group_3145

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3145

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02135
Feature type CDS
Gene -
Product DUF551 domain-containing protein
Location 404969 - 405169 (strand: -1)
Length 201 (nucleotides) / 66 (amino acids)
In genomic island GI9

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3145
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF04448 Protein of unknown function (DUF551)

Protein Sequence

MKWIKCSEKMPEDRSGVLLWDADLEEVISGHYSHKTQLFYHHGHLIENEITHWCMPPQPPEGRCTK

Flanking regions ( +/- flanking 50bp)

CGGAGTACGCAGCAGGCTGCCGTACCAGACACCGCCAAAAGGAGATGAAGATGAAATGGATTAAGTGCTCTGAAAAAATGCCGGAAGACCGCAGTGGTGTCCTGCTATGGGATGCAGACCTTGAAGAAGTAATCAGCGGCCACTACAGCCATAAAACGCAGTTGTTCTATCACCACGGACATCTTATCGAAAATGAGATTACCCACTGGTGCATGCCGCCACAACCACCGGAGGGGAGATGTACAAAATAACCGCAACGATACACAAGCCCGGCGGACTGCCGGTGAGTTGGTTCCGTCGG