Homologs in group_3135

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00085 FBDBKF_00085 100.0 Morganella morganii S1 - Phage protein
EHELCC_01460 EHELCC_01460 100.0 Morganella morganii S2 - Phage protein
LHKJJB_00035 LHKJJB_00035 100.0 Morganella morganii S3 - Phage protein
HKOGLL_00075 HKOGLL_00075 100.0 Morganella morganii S5 - Phage protein

Distribution of the homologs in the orthogroup group_3135

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3135

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02000
Feature type CDS
Gene -
Product Phage protein
Location 386719 - 386934 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)
In genomic island GI9

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3135
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSDGTKTVGTEIVIKNVIWTEYSEATQDDYIAIGKHDGQDPFAAGASRIKAVDRDRDIKGGKDDYTLTTAV

Flanking regions ( +/- flanking 50bp)

AGCCGAAATTTTCAGAGCCCATTCATATCCGGTGTGACTACGGAAGCAGGATGAGTGACGGAACAAAAACGGTAGGCACTGAAATTGTCATCAAAAATGTCATCTGGACGGAATACAGCGAAGCCACACAAGATGATTACATCGCTATCGGCAAGCATGACGGACAAGATCCGTTCGCGGCCGGAGCCAGCAGAATCAAAGCTGTTGACCGTGACCGCGATATTAAAGGCGGCAAAGATGACTACACTCTAACAACGGCGGTGTGACATGGGAGCAAGAGTAATCGGTATTAACCGTGCTGTTGCTGACCTTAATG