Homologs in group_3507

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17340 FBDBKF_17340 100.0 Morganella morganii S1 yjhX DUF2084 domain-containing protein
EHELCC_01550 EHELCC_01550 100.0 Morganella morganii S2 yjhX DUF2084 domain-containing protein
LHKJJB_00125 LHKJJB_00125 100.0 Morganella morganii S3 yjhX DUF2084 domain-containing protein
HKOGLL_00165 HKOGLL_00165 100.0 Morganella morganii S5 yjhX DUF2084 domain-containing protein

Distribution of the homologs in the orthogroup group_3507

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3507

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6T541 1.49e-43 138 90 0 85 3 KPN78578_02510 UPF0386 protein KPN78578_02510 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B6I030 2.72e-43 138 89 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli (strain SE11)
Q7CP77 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTB9 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella schwarzengrund (strain CVM19633)
B5BKW3 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella paratyphi A (strain AKU_12601)
A9N6A3 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIE1 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TG77 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella heidelberg (strain SL476)
B5R9P0 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1M7 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella enteritidis PT4 (strain P125109)
B5F4C2 4.88e-41 132 85 0 85 3 yjhX UPF0386 protein YjhX Salmonella agona (strain SL483)
Q8XF41 4.88e-41 132 85 0 85 3 yjhX2 UPF0386 protein YjhX 2 Salmonella typhi
Q8Z1D0 2.34e-40 130 84 0 85 3 yjhX1 UPF0386 protein YjhX 1 Salmonella typhi
B7NGV6 2.45e-40 130 85 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q2EEU2 2.45e-40 130 85 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli (strain K12)
B1XET3 2.45e-40 130 85 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli (strain K12 / DH10B)
C4ZRH1 2.45e-40 130 85 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli (strain K12 / MC4100 / BW2952)
B7MMJ4 2.45e-40 130 85 0 85 3 yjhX UPF0386 protein YjhX Escherichia coli O45:K1 (strain S88 / ExPEC)
B4T4A3 2.59e-40 130 84 0 85 3 yjhX UPF0386 protein YjhX Salmonella newport (strain SL254)
B5FT52 2.59e-40 130 84 0 85 3 yjhX UPF0386 protein YjhX Salmonella dublin (strain CT_02021853)
Q57G99 2.59e-40 130 84 0 85 3 yjhX UPF0386 protein YjhX Salmonella choleraesuis (strain SC-B67)
C1D6C9 1.72e-35 118 64 0 85 3 LHK_03186 UPF0386 protein LHK_03186 Laribacter hongkongensis (strain HLHK9)
Q2SFU4 6.28e-34 114 62 0 85 3 HCH_03746 UPF0386 protein HCH_03746 Hahella chejuensis (strain KCTC 2396)
A8GBZ6 9.03e-32 108 62 0 85 3 Spro_1532 UPF0386 protein Spro_1532 Serratia proteamaculans (strain 568)
A6VAQ5 1.01e-31 108 58 0 85 3 PSPA7_4799 UPF0386 protein PSPA7_4799 Pseudomonas aeruginosa (strain PA7)
B8GY96 1.3e-30 106 57 0 85 3 CCNA_00226 UPF0386 protein CCNA_00226 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABK1 1.3e-30 106 57 0 85 3 CC_0226 UPF0386 protein CC_0226 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9I5L6 1.86e-30 105 57 0 85 3 PA0712 UPF0386 protein PA0712 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UZ17 1.86e-30 105 57 0 85 3 PLES_46181 UPF0386 protein PLES_46181 Pseudomonas aeruginosa (strain LESB58)
A6WZC6 2.77e-28 100 55 1 85 3 Oant_1614 UPF0386 protein Oant_1614 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B6ITG2 5.07e-28 99 55 0 85 3 RC1_1783 UPF0386 protein RC1_1783 Rhodospirillum centenum (strain ATCC 51521 / SW)
B0T202 6.73e-28 99 52 0 85 3 Caul_4643 UPF0386 protein Caul_4643 Caulobacter sp. (strain K31)
A7HSW1 9.52e-28 99 54 0 85 3 Plav_1374 UPF0386 protein Plav_1374 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q1GJL4 1.24e-27 98 54 0 85 3 TM1040_0419 UPF0386 protein TM1040_0419 Ruegeria sp. (strain TM1040)
B2IC04 2.91e-26 95 52 0 85 3 Bind_1628 UPF0386 protein Bind_1628 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B9KN19 1.68e-25 93 54 0 84 3 RSKD131_0371 UPF0386 protein RSKD131_0371 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q5E6I2 1.83e-24 90 49 0 85 3 VF_0869 UPF0386 protein VF_0869 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0BWN3 1.37e-23 88 50 0 84 3 HNE_3437 UPF0386 protein HNE_3437 Hyphomonas neptunium (strain ATCC 15444)
Q8UFS6 2.27e-23 87 49 0 85 3 Atu1321 UPF0386 protein Atu1321 Agrobacterium fabrum (strain C58 / ATCC 33970)
B9JDN2 2.67e-23 87 50 0 85 3 Arad_1912 UPF0386 protein Arad_1912 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2K936 4.99e-23 87 49 0 85 3 RHE_CH01859 UPF0386 protein RHE_CH01859 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PXX5 2.7e-22 85 49 0 85 3 RHECIAT_CH0001945 UPF0386 protein RHECIAT_CH0001945 Rhizobium etli (strain CIAT 652)
Q1MHJ2 3.58e-22 84 48 0 85 3 RL2079 UPF0386 protein RL2079 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q11HK9 2.74e-21 82 48 0 85 3 Meso_1721 UPF0386 protein Meso_1721 Chelativorans sp. (strain BNC1)
Q2RSF1 3.43e-21 82 46 0 84 3 Rru_A2144 UPF0386 protein Rru_A2144 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q92QK6 9.57e-20 78 47 2 86 3 R01313 UPF0386 protein R01313 Rhizobium meliloti (strain 1021)
C3MAA5 9.67e-20 78 47 2 86 3 NGR_c10980 UPF0386 protein NGR_c10980 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1DBJ3 1.66e-19 78 53 0 75 3 MXAN_1729 UPF0386 protein MXAN_1729 Myxococcus xanthus (strain DK1622)
A6U820 4.77e-16 68 44 3 86 3 Smed_0945 UPF0386 protein Smed_0945 Sinorhizobium medicae (strain WSM419)
Q98ND4 1.14e-15 68 44 0 78 3 mll0189 UPF0386 protein mll0189 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_01910
Feature type CDS
Gene yjhX
Product DUF2084 domain-containing protein
Location 368998 - 369255 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)
In genomic island -

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3507
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF09857 Putative toxin of bacterial toxin-antitoxin pair

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3811 Function unknown (S) S Uncharacterized conserved protein YjhX, UPF0386/DUF2084 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09982 uncharacterized protein - -

Protein Sequence

MNLSRQEQRTLHVLAKGSRIAQVRDTSGRLIAVECYTREGLLLTDCTLATFKKLKTKKLIKSVNGQPYSINTTGLNNVRAQLDNR

Flanking regions ( +/- flanking 50bp)

CGCTATGTGTTTGCACGTTTTGCACATGATGATTAAACAGGTTTTCCAGTATGAATTTATCCCGTCAGGAACAACGTACCTTACACGTTCTCGCTAAAGGTAGTCGTATCGCGCAAGTCCGAGATACGTCTGGCCGCCTCATCGCCGTTGAATGCTACACCCGCGAAGGGCTGTTGCTTACCGACTGCACCCTTGCCACCTTCAAAAAACTCAAAACCAAAAAACTTATCAAGTCCGTTAACGGTCAGCCGTACAGCATCAACACTACCGGGCTGAATAACGTTCGCGCACAGCTTGATAACCGCTAAGGAGGCATGATGGATATTAATACCCTTATTTACGCATCCCGATATGTCCG