Homologs in group_578

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01650 FBDBKF_01650 100.0 Morganella morganii S1 yoaH YoaH family protein
EHELCC_02120 EHELCC_02120 100.0 Morganella morganii S2 yoaH YoaH family protein
LHKJJB_00695 LHKJJB_00695 100.0 Morganella morganii S3 yoaH YoaH family protein
HKOGLL_00735 HKOGLL_00735 100.0 Morganella morganii S5 yoaH YoaH family protein
F4V73_RS03990 F4V73_RS03990 75.0 Morganella psychrotolerans - YoaH family protein
PMI_RS07830 PMI_RS07830 61.7 Proteus mirabilis HI4320 - YoaH family protein

Distribution of the homologs in the orthogroup group_578

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_578

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C5BGV9 1.59e-23 86 73 1 61 3 NT01EI_1861 UPF0181 protein NT01EI_1861 Edwardsiella ictaluri (strain 93-146)
Q7N3M2 1.29e-22 84 70 0 58 3 plu2693 UPF0181 protein plu2693 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4WBG9 5.54e-21 80 67 1 61 3 Ent638_2380 UPF0181 protein Ent638_2380 Enterobacter sp. (strain 638)
B1JP39 9.11e-21 80 65 0 61 3 YPK_2448 UPF0181 protein YPK_2448 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FJ93 9.11e-21 80 65 0 61 3 YpsIP31758_2352 UPF0181 protein YpsIP31758_2352 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CH53 9.11e-21 80 65 0 61 3 YPN_2349 UPF0181 protein YPN_2349 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFE0 9.11e-21 80 65 0 61 3 YPO1774 UPF0181 protein YPO1774/y2534/YP_1619 Yersinia pestis
A9R5X0 9.11e-21 80 65 0 61 3 YpAngola_A1635 UPF0181 protein YpAngola_A1635 Yersinia pestis bv. Antiqua (strain Angola)
A4TKC8 9.11e-21 80 65 0 61 3 YPDSF_1349 UPF0181 protein YPDSF_1349 Yersinia pestis (strain Pestoides F)
Q1C8V9 9.11e-21 80 65 0 61 3 YPA_1146 UPF0181 protein YPA_1146 Yersinia pestis bv. Antiqua (strain Antiqua)
B2K0H2 9.72e-21 80 65 0 61 3 YPTS_1774 UPF0181 protein YPTS_1774 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66BW6 9.72e-21 80 65 0 61 3 YPTB1650 UPF0181 protein YPTB1650 Yersinia pseudotuberculosis serotype I (strain IP32953)
A1JLK7 1.15e-20 80 65 0 61 3 YE1782 UPF0181 protein YE1782 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P0A2M3 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2M4 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella typhi
B4TXZ4 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella schwarzengrund (strain CVM19633)
B5BHD3 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella paratyphi A (strain AKU_12601)
C0Q311 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella paratyphi C (strain RKS4594)
A9MVU3 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNL7 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUL6 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella newport (strain SL254)
B4TKF5 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella heidelberg (strain SL476)
B5R8X8 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2U7 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella enteritidis PT4 (strain P125109)
B5FTL0 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella dublin (strain CT_02021853)
Q57NI8 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella choleraesuis (strain SC-B67)
A9MNJ9 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F3R8 1.53e-20 79 68 1 60 3 yoaH UPF0181 protein YoaH Salmonella agona (strain SL483)
A6TAY2 3.5e-20 78 67 1 61 3 KPN78578_22920 UPF0181 protein KPN78578_22920 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VJ68 7.06e-20 77 62 1 61 3 ETA_15280 UPF0181 protein ETA_15280 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DG29 8.75e-20 77 61 1 60 3 PC1_1931 UPF0181 protein PC1_1931 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4EYB8 2.18e-19 76 60 0 60 3 PMI1604 UPF0181 protein PMI1604 Proteus mirabilis (strain HI4320)
A8AFP7 2.49e-19 75 66 1 60 3 CKO_01169 UPF0181 protein CKO_01169 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GFL7 5.15e-19 75 53 2 78 3 Spro_2806 UPF0181 protein Spro_2806 Serratia proteamaculans (strain 568)
B7USI6 1.47e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z2F2 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Shigella sonnei (strain Ss046)
Q32FR8 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Shigella dysenteriae serotype 1 (strain Sd197)
Q321V7 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Shigella boydii serotype 4 (strain Sb227)
B2U447 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LPN6 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RAY1 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain UTI89 / UPEC)
B6IBN8 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain SE11)
B7NBF7 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67338 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain K12)
B1IPC1 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P67339 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH22 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XH79 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain K12 / DH10B)
C4ZZG7 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain K12 / MC4100 / BW2952)
B7M285 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O8 (strain IAI1)
B7MVU0 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O81 (strain ED1a)
B7NSW4 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQV2 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67340 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O157:H7
B7L6T9 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain 55989 / EAEC)
B7MBL7 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMT4 2.31e-18 73 63 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0T504 6.06e-18 72 63 1 60 3 yoaH UPF0181 protein YoaH Shigella flexneri serotype 5b (strain 8401)
A7MKF0 9.52e-18 72 63 2 63 3 ESA_01442 UPF0181 protein ESA_01442 Cronobacter sakazakii (strain ATCC BAA-894)
B5XQ62 1.13e-17 72 70 1 55 3 KPK_1966 UPF0181 protein KPK_1966 Klebsiella pneumoniae (strain 342)
B1LD62 1.18e-17 71 61 1 60 3 yoaH UPF0181 protein YoaH Escherichia coli (strain SMS-3-5 / SECEC)
Q83L75 2.34e-17 70 63 1 60 3 yoaH UPF0181 protein YoaH Shigella flexneri
Q6D4L3 4.54e-16 68 68 0 48 3 ECA2377 UPF0181 protein ECA2377 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NTC0 4.48e-14 63 56 1 58 3 SG1330 UPF0181 protein SG1330 Sodalis glossinidius (strain morsitans)
Q65TM9 7.52e-13 59 67 1 46 3 MS1074 UPF0181 protein MS1074 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VM62 3.19e-10 52 60 0 45 3 HD_1137 UPF0181 protein HD_1137 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A5F089 3.37e-10 52 55 0 43 3 VC0395_0503 UPF0181 protein VC0395_0503/VC395_A0756 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KM20 3.37e-10 52 55 0 43 3 VC_A0569 UPF0181 protein VC_A0569 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LVI5 3.37e-10 52 55 0 43 3 VCM66_A0528 UPF0181 protein VCM66_A0528 Vibrio cholerae serotype O1 (strain M66-2)
B3H1K2 1.16e-09 51 54 0 48 3 APP7_0922 UPF0181 protein APP7_0922 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BPE7 1.16e-09 51 54 0 48 3 APJL_0874 UPF0181 protein APJL_0874 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0M3 1.16e-09 51 54 0 48 3 APL_0863 UPF0181 protein APL_0863 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CNF2 3.26e-09 50 59 0 42 3 PM0480 UPF0181 protein PM0480 Pasteurella multocida (strain Pm70)
Q87HP7 4.06e-09 50 48 0 50 3 VPA0916 UPF0181 protein VPA0916 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D757 5.76e-09 49 48 0 47 3 VV2_0310 UPF0181 protein VV2_0310 Vibrio vulnificus (strain CMCP6)
Q7ME78 6.22e-09 49 48 0 47 3 VVA0806 UPF0181 protein VVA0806 Vibrio vulnificus (strain YJ016)
P56507 2.17e-08 48 58 0 43 3 HI_1434.2 UPF0181 protein HI_1434.2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKG0 5.04e-08 47 55 0 43 3 NTHI1697 UPF0181 protein NTHI1697 Haemophilus influenzae (strain 86-028NP)
A5UEV0 6.48e-08 47 55 0 43 3 CGSHiGG_01050 UPF0181 protein CGSHiGG_01050 Haemophilus influenzae (strain PittGG)
P56506 0.000385 37 75 0 20 3 yoaH UPF0181 protein YoaH (Fragment) Klebsiella aerogenes

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_01340
Feature type CDS
Gene yoaH
Product YoaH family protein
Location 267987 - 268181 (strand: -1)
Length 195 (nucleotides) / 64 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_578
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03701 Uncharacterised protein family (UPF0181)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3140 Function unknown (S) S Uncharacterized conserved protein YoaH, UPF0181 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09917 uncharacterized protein - -

Protein Sequence

MFTGMPALSHEEQQAAVERIHTLMQQGMSSGEAIAQVAAELRERHHGGEQIRALFDEEDDDSEE

Flanking regions ( +/- flanking 50bp)

ATCTTTATGAGTATAATGTGTTTTTTACTGAAATGTTATAGAAGGTGATTATGTTTACCGGAATGCCCGCGTTAAGTCATGAAGAACAGCAGGCCGCAGTTGAGCGGATCCACACCCTGATGCAGCAAGGTATGAGCAGTGGTGAGGCTATCGCACAGGTCGCGGCGGAGTTACGCGAACGGCATCACGGCGGTGAGCAGATCCGCGCGCTGTTTGATGAGGAAGATGACGACAGCGAAGAATAGAAACAAATATTTAACAAGTGTCACAATTTCCTGATAATAAATATGTTACT