Homologs in group_2557

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02645 FBDBKF_02645 100.0 Morganella morganii S1 lrp DNA-binding transcriptional regulator, Lrp family
EHELCC_03115 EHELCC_03115 100.0 Morganella morganii S2 lrp DNA-binding transcriptional regulator, Lrp family
LHKJJB_01690 LHKJJB_01690 100.0 Morganella morganii S3 lrp DNA-binding transcriptional regulator, Lrp family
HKOGLL_01730 HKOGLL_01730 100.0 Morganella morganii S5 lrp DNA-binding transcriptional regulator, Lrp family
F4V73_RS05145 F4V73_RS05145 92.1 Morganella psychrotolerans - Lrp/AsnC family transcriptional regulator

Distribution of the homologs in the orthogroup group_2557

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2557

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52710 7.18e-29 106 39 0 143 4 putR Proline dehydrogenase transcriptional activator Rhodobacter capsulatus
Q9I1M3 4.81e-28 104 38 0 150 3 bkdR Bkd operon transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37425 9.45e-28 103 38 0 148 3 lrp Leucine-responsive regulatory protein Serratia marcescens
P0ACJ3 9.76e-28 103 38 0 148 3 lrp Leucine-responsive regulatory protein Shigella flexneri
P0ACJ4 9.76e-28 103 38 0 148 3 lrp Leucine-responsive regulatory protein Klebsiella aerogenes
P0ACJ0 9.76e-28 103 38 0 148 1 lrp Leucine-responsive regulatory protein Escherichia coli (strain K12)
P0ACJ1 9.76e-28 103 38 0 148 3 lrp Leucine-responsive regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ2 9.76e-28 103 38 0 148 3 lrp Leucine-responsive regulatory protein Escherichia coli O157:H7
Q44333 1.04e-27 103 36 0 142 4 putR Proline dehydrogenase transcriptional activator Rhizobium radiobacter
P37424 3.14e-27 102 37 0 148 3 lrp Leucine-responsive regulatory protein Klebsiella pneumoniae
P0A2S0 5.57e-27 102 37 0 148 3 lrp Leucine-responsive regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42179 1.45e-26 100 35 1 150 4 bkdR Bkd operon transcriptional regulator Pseudomonas putida
P0ACJ5 1.69e-26 100 32 0 150 1 decR DNA-binding transcriptional activator DecR Escherichia coli (strain K12)
P0ACJ6 1.69e-26 100 32 0 150 3 decR DNA-binding transcriptional activator DecR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ7 1.69e-26 100 32 0 150 3 decR DNA-binding transcriptional activator DecR Escherichia coli O157:H7
P56901 6.88e-26 99 35 0 150 3 lrp Leucine-responsive regulatory protein Rhizobium meliloti (strain 1021)
E1V7V9 7.33e-26 99 36 0 142 3 doeX Transcriptional regulatory protein DoeX Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
P45265 6.17e-25 96 35 0 142 3 lrp Leucine-responsive regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
F8DT92 6.45e-22 89 33 1 150 4 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
P0DJA5 6.66e-22 89 33 1 150 3 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P50337 8.65e-22 87 36 0 120 4 NGR_a01600 Uncharacterized HTH-type transcriptional regulator y4sM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O07920 1.76e-19 82 30 0 139 4 azlB Transcriptional regulator AzlB Bacillus subtilis (strain 168)
O59188 6.93e-19 80 30 2 150 1 fl11 HTH-type transcriptional regulator FL11 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P0DJA6 8.46e-18 78 34 2 122 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
F8DT24 1.4e-17 77 34 2 122 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
Q8U0P3 2.35e-17 77 28 2 150 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9V0Y9 6.89e-16 73 27 2 150 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus abyssi (strain GE5 / Orsay)
P44580 1.66e-15 72 28 0 140 4 HI_0224 Uncharacterized HTH-type transcriptional regulator HI_0224 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P55658 3.02e-14 69 26 0 150 4 NGR_a01550 Uncharacterized HTH-type transcriptional regulator y4tD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q58133 1.74e-13 66 29 2 143 1 ptr2 HTH-type transcriptional regulator Ptr2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O31497 7.34e-12 62 32 2 125 4 yezC Uncharacterized HTH-type transcriptional regulator YezC Bacillus subtilis (strain 168)
P96582 1.26e-11 61 30 1 117 1 lrpC HTH-type transcriptional regulator LrpC Bacillus subtilis (strain 168)
Q57615 1.03e-10 59 23 2 151 1 ptr1 HTH-type transcriptional regulator Ptr1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0ACI9 1.05e-10 59 24 2 145 3 asnC Regulatory protein AsnC Shigella flexneri
P0ACI6 1.05e-10 59 24 2 145 1 asnC Regulatory protein AsnC Escherichia coli (strain K12)
P0ACI7 1.05e-10 59 24 2 145 3 asnC Regulatory protein AsnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI8 1.05e-10 59 24 2 145 3 asnC Regulatory protein AsnC Escherichia coli O157:H7
Q8U4M7 1.15e-10 59 28 0 119 4 PF0054 Uncharacterized HTH-type transcriptional regulator PF0054 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P42180 1.85e-10 58 27 4 143 1 lrpA HTH-type transcriptional regulator LrpA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O57818 3.38e-09 55 25 0 117 4 PH0045 Uncharacterized HTH-type transcriptional regulator PH0045 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O59256 3.84e-09 55 25 1 140 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UY16 4.33e-09 55 24 3 145 4 PYRAB16920 Uncharacterized HTH-type transcriptional regulator PYRAB16920 Pyrococcus abyssi (strain GE5 / Orsay)
Q9V159 1.21e-08 53 25 1 140 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus abyssi (strain GE5 / Orsay)
O59579 1.82e-08 53 25 3 140 4 PH1916 Uncharacterized HTH-type transcriptional regulator PH1916 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O57880 1.91e-08 53 24 1 137 1 PH0140 Uncharacterized HTH-type transcriptional regulator PH0140 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V2D7 5.95e-08 52 24 2 142 4 PYRAB01370 Uncharacterized HTH-type transcriptional regulator PYRAB01370 Pyrococcus abyssi (strain GE5 / Orsay)
P44337 7.01e-08 52 24 2 145 3 asnC Regulatory protein AsnC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9V2M0 8.95e-08 51 26 0 117 4 PYRAB00550 Uncharacterized HTH-type transcriptional regulator PYRAB00550 Pyrococcus abyssi (strain GE5 / Orsay)
Q8U067 4.22e-06 47 34 0 67 4 PF1734 Uncharacterized HTH-type transcriptional regulator PF1734 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9V1E5 6.93e-06 46 20 2 140 4 PYRAB04820 Uncharacterized HTH-type transcriptional regulator PYRAB04820 Pyrococcus abyssi (strain GE5 / Orsay)
Q8U2H1 1.01e-05 46 24 2 137 1 PF0864 Uncharacterized HTH-type transcriptional regulator PF0864 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P96653 1.61e-05 45 29 1 119 4 lrpB HTH-type transcriptional regulator LrpB Bacillus subtilis (strain 168)
O59309 3.05e-05 44 31 0 67 4 PH1692 Uncharacterized HTH-type transcriptional regulator PH1692 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O05217 7.6e-05 43 30 0 72 4 ywrC Uncharacterized HTH-type transcriptional regulator YwrC Bacillus subtilis (strain 168)
Q8U1H7 7.75e-05 43 22 1 138 4 PF1231 Uncharacterized HTH-type transcriptional regulator PF1231 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B0R717 0.000263 42 25 2 124 4 lrp HTH-type transcriptional regulator Lrp Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O58741 0.001 40 36 1 65 4 PH1013 Uncharacterized HTH-type transcriptional regulator PH1013 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_00345
Feature type CDS
Gene lrp
Product DNA-binding transcriptional regulator, Lrp family
Location 64627 - 65082 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2557
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01037 Lrp/AsnC ligand binding domain
PF13412 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1522 Transcription (K) K DNA-binding transcriptional regulator, Lrp family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03719 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein - -

Protein Sequence

MDSFDRKILSELQLDGRLTVTELADRVGLSLSPCHRRLKALEQSGAICDYRAQLDPRVLGLNFSALVFVTMKDGNQESMSKFETAVADIPQIIEAKRLFGDPDYMLTVVVKDIDAFQKLYDSRLAAMPGVQRLTSTLVMKDVIPARELPLL

Flanking regions ( +/- flanking 50bp)

TGCTTGCTAATCAGACCCTGATTTACCTTATTTGAGGGAGAAAATCATCAATGGACAGCTTTGACAGGAAGATTCTTTCTGAATTACAACTCGACGGGCGATTAACTGTCACTGAGCTGGCAGATCGCGTGGGTCTGAGTTTATCCCCTTGCCACCGGCGGCTGAAAGCACTGGAGCAATCCGGGGCTATCTGTGATTACCGCGCACAGCTTGATCCGCGCGTGCTGGGGCTGAATTTTTCCGCACTGGTGTTTGTCACTATGAAAGACGGCAACCAGGAAAGTATGAGCAAATTTGAGACAGCGGTGGCGGATATTCCGCAGATTATCGAAGCCAAACGGCTGTTTGGCGATCCGGACTATATGCTGACCGTCGTGGTCAAAGATATCGATGCCTTTCAGAAATTATATGACAGCCGCCTGGCCGCCATGCCGGGAGTTCAGCGCCTGACCTCCACCCTGGTGATGAAAGATGTGATCCCGGCGCGGGAACTGCCCCTGTTGTAACAAAAAAAGCCGGCAATATCTGCCGGCAAGCAACACAGTACTGAATCTTT