Homologs in group_1283

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07800 FBDBKF_07800 87.5 Morganella morganii S1 xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA
EHELCC_13630 EHELCC_13630 87.5 Morganella morganii S2 xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA
NLDBIP_14075 NLDBIP_14075 87.5 Morganella morganii S4 xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA
LHKJJB_08775 LHKJJB_08775 87.5 Morganella morganii S3 xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA
HKOGLL_08325 HKOGLL_08325 87.5 Morganella morganii S5 xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA
F4V73_RS13245 F4V73_RS13245 79.2 Morganella psychrotolerans xdhA xanthine dehydrogenase molybdenum-binding subunit XdhA

Distribution of the homologs in the orthogroup group_1283

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1283

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8X6C7 2.7e-23 94 65 0 70 3 xdhA Xanthine dehydrogenase molybdenum-binding subunit Escherichia coli O157:H7
Q46799 2.75e-23 94 65 0 70 2 xdhA Putative xanthine dehydrogenase molybdenum-binding subunit XdhA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19970
Feature type CDS
Gene xdhA
Product Xanthine dehydrogenase subunit XdhA
Location 5 - 223 (strand: 1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession ZDB_506
Length 285 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1283
Orthogroup size 7
N. genomes 6

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1529 Energy production and conversion (C) C Aldehyde, CO or xanthine dehydrogenase, Mo-binding subunit

Protein Sequence

MVDLPALVCGFVETYDPQSAYAHHFLAEPPTIAPAAAIRNAVRMATGISVNTIPLTPKRLYREFVNAGLMRG

Flanking regions ( +/- flanking 50bp)

GCCCATGGTTGACCTGCCGGCTCTGGTTTGCGGTTTTGTTGAAACCTACGACCCGCAGTCCGCTTATGCCCATCACTTCCTGGCAGAGCCCCCGACTATTGCGCCGGCTGCCGCTATCCGTAACGCCGTGCGTATGGCGACGGGTATTTCTGTCAATACTATCCCGCTGACGCCAAAACGGCTGTACCGGGAATTTGTTAATGCCGGGCTTATGAGGGGGTAGCTGCCATGTATGATTTTGAAACTTATCACCGCGCGGAGAGTGTCGCACAT