Homologs in group_3666

Help

3 homologs were identified in 3 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20145 FBDBKF_20145 100.0 Morganella morganii S1 ble bleomycin binding protein Ble-MBL
NLDBIP_19600 NLDBIP_19600 100.0 Morganella morganii S4 ble bleomycin binding protein Ble-MBL
HKOGLL_19480 HKOGLL_19480 100.0 Morganella morganii S5 ble bleomycin binding protein Ble-MBL

Distribution of the homologs in the orthogroup group_3666

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3666

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13081 1.97e-25 94 54 0 84 1 ble Bleomycin resistance protein Klebsiella pneumoniae

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19565
Feature type CDS
Gene ble
Product bleomycin binding protein Ble-MBL
Location 5480 - 5740 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession ZDB_394
Length 7614 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3666
Orthogroup size 4
N. genomes 4

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0346 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
ble bleomycin binding protein Ble-MBL core AMR BLEOMYCIN BLEOMYCIN None

Protein Sequence

MILQRGGLQLEFFPYPDLDPATSSFGCCLRLDDLDAMVALVNAAGAEEKSTGWPRFKAPQLEASGLRIGYLIDPDCTLVRLIQNPD

Flanking regions ( +/- flanking 50bp)

CGTTTTATGCGAAGCTGGGCTTTGCGACGAGTTGGAAGGATCGCGGCTGGATGATCCTGCAGCGCGGCGGTTTGCAGCTCGAATTCTTCCCCTATCCTGACCTCGACCCAGCTACGAGCTCGTTCGGCTGTTGCCTGCGGTTGGATGATCTCGATGCCATGGTGGCATTGGTGAACGCGGCGGGAGCCGAGGAAAAAAGCACCGGCTGGCCGCGCTTCAAAGCTCCGCAACTGGAGGCGAGCGGCCTGAGGATCGGCTACCTGATCGATCCCGACTGCACGCTGGTGCGGCTGATCCAGAACCCCGACTGACCGCATGCCCGCGAAAATCAAGATTTGCGGGATCAGCACACCCGAGGCGC