Homologs in group_3623

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20320 FBDBKF_20320 100.0 Morganella morganii S1 tnp IS1 family transposase
EHELCC_19050 EHELCC_19050 100.0 Morganella morganii S2 tnp IS1 family transposase
NLDBIP_19525 NLDBIP_19525 100.0 Morganella morganii S4 tnp IS1 family transposase
HKOGLL_19405 HKOGLL_19405 100.0 Morganella morganii S5 tnp IS1 family transposase

Distribution of the homologs in the orthogroup group_3623

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3623

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P19765 2.49e-85 247 95 0 125 3 insB1 Insertion element IS1 protein InsB Shigella flexneri
P19766 7.81e-84 243 92 0 125 3 insB Insertion element IS1 protein InsB Shigella sonnei
P03831 1.06e-83 243 92 0 125 3 insB Insertion element iso-IS1d protein InsB Shigella dysenteriae
P59843 1.29e-83 244 92 0 125 3 insB Insertion element IS1 protein InsB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0A385XJL4 1.29e-83 244 92 0 125 3 insB9 Insertion element IS1 9 protein InsB Escherichia coli (strain K12)
P0CF30 1.29e-83 244 92 0 125 3 JW2285 Insertion element IS1 8 protein InsB Escherichia coli (strain K12)
P0CF29 1.29e-83 244 92 0 125 3 insB6 Insertion element IS1 6 protein InsB Escherichia coli (strain K12)
P0CF28 1.29e-83 244 92 0 125 3 insB5 Insertion element IS1 5 protein InsB Escherichia coli (strain K12)
P0CF25 1.29e-83 244 92 0 125 3 insB1 Insertion element IS1 1 protein InsB Escherichia coli (strain K12)
P57998 1.65e-83 244 92 0 125 3 insB4 Insertion element IS1 4 protein InsB Escherichia coli (strain K12)
P0CF31 1.68e-83 244 92 0 125 3 insB Insertion element IS1 protein InsB Escherichia coli
P0CF27 2.05e-83 244 92 0 125 3 insB3 Insertion element IS1 3 protein InsB Escherichia coli (strain K12)
P0CF26 2.05e-83 244 92 0 125 3 insB2 Insertion element IS1 2 protein InsB Escherichia coli (strain K12)
P03832 4.37e-35 120 46 0 119 3 insB Insertion element iso-IS1n protein InsB Shigella dysenteriae

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19540
Feature type CDS
Gene tnp
Product IS1 family transposase
Location 9901 - 10278 (strand: 1)
Length 378 (nucleotides) / 125 (amino acids)
In genomic island -

Contig

Accession ZDB_393
Length 10442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3623
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF03400 IS1 transposase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1662 Mobilome: prophages, transposons (X) X Transposase and inactivated derivatives, IS1 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07480 insertion element IS1 protein InsB - -

Protein Sequence

MDEQWGYVGAKSRQRWLFYAYDRIRRAVVAHVFGERTMATLERLLSLLSVFDVVVWMTDGWPMYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

Flanking regions ( +/- flanking 50bp)

CAGTAACCTCCCGGATACAGCCGGGCAGTGATGTCATTGTCTGTGCGGAGATGGACGAGCAATGGGGCTACGTCGGTGCAAAATCACGTCAGCGCTGGCTGTTTTACGCGTATGACAGGATACGCAGGGCGGTGGTAGCCCACGTTTTCGGTGAACGCACTATGGCCACACTGGAGCGTCTTCTGAGCCTGCTGTCAGTTTTTGACGTGGTGGTATGGATGACGGACGGCTGGCCGATGTATGAGTCACGTCTGAAGGGAAAACTGCACGTCATCAGTAAGCGTTACACGCAGCGAATTGAGCGACACAACCTGAATCTGAGACAGCATCTGGCAAGGCTGGGCAGGAAGTCCCTGTCGTTCTCAAAATCGGTGGAGCTGCATGACAAAGTCATCGGGCACTATCTGAACATAAAACACTATCAGTAAATTGGAGTCATTACCGTGTCACAGATGCGAAAAAGCAATTAAGTGCATAT