Homologs in group_2423

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19200 FBDBKF_19200 100.0 Morganella morganii S1 rpsQ 30S ribosomal protein S17
EHELCC_18945 EHELCC_18945 100.0 Morganella morganii S2 rpsQ 30S ribosomal protein S17
NLDBIP_18960 NLDBIP_18960 100.0 Morganella morganii S4 rpsQ 30S ribosomal protein S17
HKOGLL_18550 HKOGLL_18550 100.0 Morganella morganii S5 rpsQ 30S ribosomal protein S17
F4V73_RS18965 F4V73_RS18965 91.7 Morganella psychrotolerans rpsQ 30S ribosomal protein S17
PMI_RS16195 PMI_RS16195 91.7 Proteus mirabilis HI4320 rpsQ 30S ribosomal protein S17

Distribution of the homologs in the orthogroup group_2423

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2423

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYG0 1.73e-53 163 95 0 84 3 rpsQ Small ribosomal subunit protein uS17 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YWU8 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella sonnei (strain Ss046)
P0AG66 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella flexneri
Q0SZZ1 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella flexneri serotype 5b (strain 8401)
Q32B40 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW5 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella boydii serotype 4 (strain Sb227)
B2U2S9 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B4F1J3 9.17e-53 162 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Proteus mirabilis (strain HI4320)
B7LRS7 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R616 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain UTI89 / UPEC)
B1LHC5 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain SMS-3-5 / SECEC)
B6I225 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain SE11)
B7NDT2 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG63 9.17e-53 162 94 0 84 1 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain K12)
B1IPY8 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AG64 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF0 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK0 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O1:K1 / APEC
A8A5B6 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O9:H4 (strain HS)
B1X6G3 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain K12 / DH10B)
C4ZUG6 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M5 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O8 (strain IAI1)
B7N0V1 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O81 (strain ED1a)
B7NLN0 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN2 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG65 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O157:H7
B7L4K0 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli (strain 55989 / EAEC)
B7MCS6 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK35 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK0 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPH2 9.17e-53 162 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Cronobacter sakazakii (strain ATCC BAA-894)
C6DG65 1.36e-52 161 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX9 1.36e-52 161 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TEW3 1.85e-52 161 94 0 84 3 rpsQ Small ribosomal subunit protein uS17 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P66451 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66452 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella typhi
B4TXD3 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella schwarzengrund (strain CVM19633)
B5BGX7 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella paratyphi A (strain AKU_12601)
C0Q0A7 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella paratyphi C (strain RKS4594)
A9MSY9 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU2 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT1 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella newport (strain SL254)
B4TKK6 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella heidelberg (strain SL476)
B5RH24 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R282 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella enteritidis PT4 (strain P125109)
B5FJK5 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella dublin (strain CT_02021853)
Q57J41 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella choleraesuis (strain SC-B67)
A9MN57 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T6 1.96e-52 160 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Salmonella agona (strain SL483)
B1JIX0 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T0 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH01 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pestis (strain Pestoides F)
Q1CCV3 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJA3 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pestis
B2K5M1 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V6 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JS24 3.24e-52 160 91 0 84 3 rpsQ Small ribosomal subunit protein uS17 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WFB9 5.67e-52 159 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Enterobacter sp. (strain 638)
A8AQK7 5.74e-52 159 92 0 84 3 rpsQ Small ribosomal subunit protein uS17 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VK55 1.15e-50 156 90 0 84 3 rpsQ Small ribosomal subunit protein uS17 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P46175 1.71e-49 153 89 0 84 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Acyrthosiphon kondoi
A8GKI8 1.85e-49 153 88 0 84 3 rpsQ Small ribosomal subunit protein uS17 Serratia proteamaculans (strain 568)
Q2NQN1 6.49e-48 149 84 0 84 3 rpsQ Small ribosomal subunit protein uS17 Sodalis glossinidius (strain morsitans)
P44383 1.04e-47 149 85 0 84 3 rpsQ Small ribosomal subunit protein uS17 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT9 1.04e-47 149 85 0 84 3 rpsQ Small ribosomal subunit protein uS17 Haemophilus influenzae (strain PittGG)
A5UDT8 1.04e-47 149 85 0 84 3 rpsQ Small ribosomal subunit protein uS17 Haemophilus influenzae (strain PittEE)
Q4QMB3 1.04e-47 149 85 0 84 3 rpsQ Small ribosomal subunit protein uS17 Haemophilus influenzae (strain 86-028NP)
P55829 1.36e-47 149 84 0 84 3 rpsQ Small ribosomal subunit protein uS17 Aggregatibacter actinomycetemcomitans
Q5E8A6 1.76e-47 148 81 0 82 3 rpsQ Small ribosomal subunit protein uS17 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7FNM6 4.99e-47 147 92 0 76 3 rpsQ Small ribosomal subunit protein uS17 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9CL40 6.93e-47 147 83 0 84 3 rpsQ Small ribosomal subunit protein uS17 Pasteurella multocida (strain Pm70)
Q7MPH9 8.1e-47 147 84 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio vulnificus (strain YJ016)
Q8DE48 8.1e-47 147 84 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio vulnificus (strain CMCP6)
C3LRP9 1.05e-46 146 82 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ3 1.05e-46 146 82 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F557 1.05e-46 146 82 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EPT4 8.31e-46 144 80 0 82 3 rpsQ Small ribosomal subunit protein uS17 Aliivibrio salmonicida (strain LFI1238)
A0KF30 1.2e-45 144 84 0 82 3 rpsQ Small ribosomal subunit protein uS17 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SSZ7 1.23e-45 144 82 0 82 3 rpsQ Small ribosomal subunit protein uS17 Aeromonas salmonicida (strain A449)
B0BSU0 3.54e-45 142 84 0 83 3 rpsQ Small ribosomal subunit protein uS17 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ20 3.54e-45 142 84 0 83 3 rpsQ Small ribosomal subunit protein uS17 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N367 3.54e-45 142 84 0 83 3 rpsQ Small ribosomal subunit protein uS17 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F764 4.66e-45 142 83 0 83 3 rpsQ Small ribosomal subunit protein uS17 Glaesserella parasuis serovar 5 (strain SH0165)
Q65QW4 2.02e-44 140 81 0 83 3 rpsQ Small ribosomal subunit protein uS17 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKE0 2.58e-44 140 83 0 83 3 rpsQ Small ribosomal subunit protein uS17 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A7N0I6 1.04e-43 139 78 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio campbellii (strain ATCC BAA-1116)
A6VLJ7 2.91e-43 137 78 0 84 3 rpsQ Small ribosomal subunit protein uS17 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q87T04 3.97e-43 137 78 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A3Q991 7.64e-43 136 78 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0UX22 7.93e-43 136 80 0 82 3 rpsQ Small ribosomal subunit protein uS17 Histophilus somni (strain 2336)
Q0I154 7.93e-43 136 80 0 82 3 rpsQ Small ribosomal subunit protein uS17 Histophilus somni (strain 129Pt)
C4L7T9 1.06e-42 136 81 0 82 3 rpsQ Small ribosomal subunit protein uS17 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A8GYY5 2.5e-42 135 76 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q6LVA7 2.83e-42 135 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Photobacterium profundum (strain SS9)
B0TM03 3.59e-42 135 75 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella halifaxensis (strain HAW-EB4)
B8CNE2 5.7e-42 134 75 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8K959 1.05e-41 134 69 0 84 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B1KMX4 1.55e-41 133 75 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella woodyi (strain ATCC 51908 / MS32)
B8D840 1.78e-41 133 71 0 82 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57582 1.78e-41 133 71 0 82 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9T8 1.78e-41 133 71 0 82 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A8G1D9 1.82e-41 133 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella sediminis (strain HAW-EB3)
A1REC3 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella sp. (strain W3-18-1)
A4YBX4 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWB1 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella baltica (strain OS195)
A6WHT7 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella baltica (strain OS185)
A3DA63 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ6 2.77e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella baltica (strain OS223)
Q0I096 4.69e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella sp. (strain MR-7)
Q0HNS8 4.69e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella sp. (strain MR-4)
A0KRN3 4.69e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella sp. (strain ANA-3)
Q8EK60 4.69e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1S227 5.12e-41 132 74 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q3IFM3 1.1e-40 131 74 0 81 3 rpsQ Small ribosomal subunit protein uS17 Pseudoalteromonas translucida (strain TAC 125)
B7VLE8 5.32e-40 129 73 0 82 3 rpsQ Small ribosomal subunit protein uS17 Vibrio atlanticus (strain LGP32)
Q12SV0 6.32e-40 129 73 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1LTC9 6.36e-40 129 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K7A9 1.38e-39 128 67 0 83 3 rpsQ Small ribosomal subunit protein uS17 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q089P5 1.29e-38 126 68 0 82 3 rpsQ Small ribosomal subunit protein uS17 Shewanella frigidimarina (strain NCIMB 400)
Q89A75 2.84e-38 125 62 0 83 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9HWE4 5.09e-38 124 69 0 79 1 rpsQ Small ribosomal subunit protein uS17 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T71 5.09e-38 124 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V653 5.09e-38 124 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas aeruginosa (strain LESB58)
A6UZJ7 5.09e-38 124 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas aeruginosa (strain PA7)
B1JDX5 7.23e-38 124 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas putida (strain W619)
B0KK76 7.23e-38 124 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas putida (strain GB-1)
Q1IFV7 7.23e-38 124 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas entomophila (strain L48)
Q88QM6 1.29e-37 124 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXQ6 1.29e-37 124 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q2S921 1.47e-37 123 69 0 78 3 rpsQ Small ribosomal subunit protein uS17 Hahella chejuensis (strain KCTC 2396)
A1TYK6 3.39e-37 122 65 0 82 3 rpsQ Small ribosomal subunit protein uS17 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C3K2W7 4.09e-37 122 70 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas fluorescens (strain SBW25)
B0V6X7 5.44e-37 122 71 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain AYE)
A3M975 5.44e-37 122 71 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQS7 5.44e-37 122 71 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain SDF)
B2HZ99 5.44e-37 122 71 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain ACICU)
B7IA30 5.44e-37 122 71 1 84 1 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain AB0057)
B7GW11 5.44e-37 122 71 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baumannii (strain AB307-0294)
Q3K5Z7 8.72e-37 121 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas fluorescens (strain Pf0-1)
Q4K542 8.72e-37 121 69 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZMQ3 2.37e-36 120 68 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas syringae pv. syringae (strain B728a)
Q889W2 2.37e-36 120 68 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D45 2.37e-36 120 68 0 79 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6W383 3.91e-36 120 68 0 80 3 rpsQ Small ribosomal subunit protein uS17 Marinomonas sp. (strain MWYL1)
A1KRI2 9.26e-36 119 67 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDT3 9.26e-36 119 67 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQL7 9.26e-36 119 67 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3V7 9.26e-36 119 67 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria meningitidis serogroup C (strain 053442)
Q6F7S1 9.54e-36 119 69 1 84 3 rpsQ Small ribosomal subunit protein uS17 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q21M49 5.51e-35 117 67 0 78 3 rpsQ Small ribosomal subunit protein uS17 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BQ70 7.25e-35 117 66 0 78 3 rpsQ Small ribosomal subunit protein uS17 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B4RQY6 1.5e-34 115 66 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T6 1.5e-34 115 66 0 81 3 rpsQ Small ribosomal subunit protein uS17 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q15YN0 1.82e-34 115 66 0 77 3 rpsQ Small ribosomal subunit protein uS17 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C1DKM2 4.68e-34 114 71 0 71 3 rpsQ Small ribosomal subunit protein uS17 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4FUE7 5.27e-34 114 68 0 80 3 rpsQ Small ribosomal subunit protein uS17 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A4XZ81 6.29e-34 114 71 0 71 3 rpsQ Small ribosomal subunit protein uS17 Pseudomonas mendocina (strain ymp)
A4VHN9 7.18e-34 114 71 0 71 3 rpsQ Small ribosomal subunit protein uS17 Stutzerimonas stutzeri (strain A1501)
Q1QDH7 7.74e-34 114 72 0 74 3 rpsQ Small ribosomal subunit protein uS17 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q605C1 9.01e-34 114 62 0 80 3 rpsQ Small ribosomal subunit protein uS17 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5EX90 2.28e-33 113 66 0 77 3 rpsQ Small ribosomal subunit protein uS17 Dichelobacter nodosus (strain VCS1703A)
Q493J9 2.75e-33 112 60 0 82 3 rpsQ Small ribosomal subunit protein uS17 Blochmanniella pennsylvanica (strain BPEN)
Q5QXX3 3.42e-33 112 61 1 86 3 rpsQ Small ribosomal subunit protein uS17 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4IZS5 8.28e-33 111 60 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHV9 8.28e-33 111 60 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4J2 8.28e-33 111 60 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. novicida (strain U112)
B2SDX6 8.28e-33 111 60 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JB1 8.28e-33 111 60 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. tularensis (strain FSC 198)
Q1H4M8 1.23e-32 111 64 0 78 3 rpsQ Small ribosomal subunit protein uS17 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8D203 2.28e-32 110 62 0 75 3 rpsQ Small ribosomal subunit protein uS17 Wigglesworthia glossinidia brevipalpis
Q1R0G6 3.51e-32 110 61 0 80 3 rpsQ Small ribosomal subunit protein uS17 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0BNR8 5.11e-32 109 59 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5G1 5.11e-32 109 59 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T4 5.11e-32 109 59 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0U0Y0 7.26e-32 108 59 0 81 3 rpsQ Small ribosomal subunit protein uS17 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0ABG6 7.54e-32 109 58 0 78 3 rpsQ Small ribosomal subunit protein uS17 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WVB3 1.23e-31 108 65 0 78 3 rpsQ Small ribosomal subunit protein uS17 Halorhodospira halophila (strain DSM 244 / SL1)
Q5WZK3 2.82e-31 107 67 0 74 3 rpsQ Small ribosomal subunit protein uS17 Legionella pneumophila (strain Lens)
Q5ZYN4 2.82e-31 107 67 0 74 3 rpsQ Small ribosomal subunit protein uS17 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHQ5 2.82e-31 107 67 0 74 3 rpsQ Small ribosomal subunit protein uS17 Legionella pneumophila (strain Corby)
Q5X850 2.82e-31 107 67 0 74 3 rpsQ Small ribosomal subunit protein uS17 Legionella pneumophila (strain Paris)
Q3J8S3 3.63e-31 107 65 0 76 3 rpsQ Small ribosomal subunit protein uS17 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P38519 6.28e-31 107 61 0 76 3 rpsQ Small ribosomal subunit protein uS17 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B3PK46 6.58e-31 107 60 0 78 3 rpsQ Small ribosomal subunit protein uS17 Cellvibrio japonicus (strain Ueda107)
A4JAP9 1.37e-30 106 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ37 1.37e-30 106 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRN8 1.37e-30 106 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia ambifaria (strain MC40-6)
Q488A2 1.65e-30 105 64 0 79 3 rpsQ Small ribosomal subunit protein uS17 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7NQG1 1.73e-30 105 62 0 78 3 rpsQ Small ribosomal subunit protein uS17 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0RU73 2.05e-30 105 55 0 80 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas campestris pv. campestris (strain B100)
A5IM92 2.07e-30 106 62 0 74 3 rpsQ Small ribosomal subunit protein uS17 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q11QC1 2.16e-30 105 68 0 73 3 rpsQ Small ribosomal subunit protein uS17 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B8GV49 2.33e-30 105 62 0 78 3 rpsQ Small ribosomal subunit protein uS17 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q8PC41 3.5e-30 105 55 0 80 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URE8 3.5e-30 105 55 0 80 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas campestris pv. campestris (strain 8004)
Q057B3 6.41e-30 104 55 0 84 3 rpsQ Small ribosomal subunit protein uS17 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A5WCJ9 6.88e-30 104 71 0 73 3 rpsQ Small ribosomal subunit protein uS17 Psychrobacter sp. (strain PRwf-1)
Q1LI46 7.7e-30 104 63 0 77 3 rpsQ Small ribosomal subunit protein uS17 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9KJI5 8.77e-30 103 63 0 77 3 rpsQ Small ribosomal subunit protein uS17 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A6LPS0 1.16e-29 103 69 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B8I7Y8 1.42e-29 103 63 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A6TWH3 1.98e-29 103 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Alkaliphilus metalliredigens (strain QYMF)
B9K895 2.04e-29 103 63 0 72 3 rpsQ Small ribosomal subunit protein uS17 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q3SLP0 2.75e-29 102 60 0 78 3 rpsQ Small ribosomal subunit protein uS17 Thiobacillus denitrificans (strain ATCC 25259)
Q7VQD9 3.09e-29 102 56 0 81 3 rpsQ Small ribosomal subunit protein uS17 Blochmanniella floridana
C1B021 3.15e-29 102 67 1 79 3 rpsQ Small ribosomal subunit protein uS17 Rhodococcus opacus (strain B4)
Q0S3G7 3.15e-29 102 67 1 79 3 rpsQ Small ribosomal subunit protein uS17 Rhodococcus jostii (strain RHA1)
Q2YAY8 3.8e-29 102 63 0 77 3 rpsQ Small ribosomal subunit protein uS17 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B4SKX2 4.51e-29 102 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Stenotrophomonas maltophilia (strain R551-3)
Q1BRV7 5.23e-29 102 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia orbicola (strain AU 1054)
B1JU31 5.23e-29 102 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia orbicola (strain MC0-3)
Q39KF8 5.23e-29 102 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5C9 5.23e-29 102 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N4 5.23e-29 102 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia cenocepacia (strain HI2424)
B2FQJ3 5.8e-29 102 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Stenotrophomonas maltophilia (strain K279a)
A3DJI1 6.38e-29 101 61 0 73 3 rpsQ Small ribosomal subunit protein uS17 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B0TC65 6.46e-29 101 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B1LBN1 6.59e-29 102 60 0 74 3 rpsQ Small ribosomal subunit protein uS17 Thermotoga sp. (strain RQ2)
B2JI57 7.51e-29 101 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A2SLE8 7.51e-29 101 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q5GWU3 9.19e-29 101 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQR9 9.19e-29 101 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZZ4 9.19e-29 101 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWX4 9.19e-29 101 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNR6 9.19e-29 101 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Xanthomonas axonopodis pv. citri (strain 306)
A9NAX9 1.05e-28 101 64 0 78 3 rpsQ Small ribosomal subunit protein uS17 Coxiella burnetii (strain RSA 331 / Henzerling II)
B3R7R4 1.29e-28 101 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K628 1.29e-28 101 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B5ELY8 1.32e-28 101 59 0 79 3 rpsQ Small ribosomal subunit protein uS17 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J476 1.32e-28 101 59 0 79 3 rpsQ Small ribosomal subunit protein uS17 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A8ZV66 1.36e-28 100 57 0 78 3 rpsQ Small ribosomal subunit protein uS17 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q46WF3 1.47e-28 100 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1TJ16 1.61e-28 100 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Paracidovorax citrulli (strain AAC00-1)
Q0SQF3 1.63e-28 100 67 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium perfringens (strain SM101 / Type A)
Q8XHT2 1.92e-28 100 67 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium perfringens (strain 13 / Type A)
Q0TMQ5 1.92e-28 100 67 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A9ADK2 2.08e-28 100 58 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia multivorans (strain ATCC 17616 / 249)
C4Z2T9 2.46e-28 100 58 0 77 3 rpsQ Small ribosomal subunit protein uS17 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
B3EP52 2.63e-28 100 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Chlorobium phaeobacteroides (strain BS1)
Q2SU36 2.8e-28 100 58 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q47J94 2.95e-28 100 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Dechloromonas aromatica (strain RCB)
A8M520 3.07e-28 100 66 0 74 3 rpsQ Small ribosomal subunit protein uS17 Salinispora arenicola (strain CNS-205)
A0PXV5 3.62e-28 99 68 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium novyi (strain NT)
A8MLE9 3.74e-28 99 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Alkaliphilus oremlandii (strain OhILAs)
Q6AD04 4.35e-28 100 63 0 74 3 rpsQ Small ribosomal subunit protein uS17 Leifsonia xyli subsp. xyli (strain CTCB07)
B1IGE5 4.51e-28 99 63 0 77 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Okra / Type B1)
B2UEL0 5.02e-28 99 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ralstonia pickettii (strain 12J)
C5CP44 5.25e-28 99 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Variovorax paradoxus (strain S110)
C5CGQ5 5.92e-28 99 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A1KB18 6.25e-28 99 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Azoarcus sp. (strain BH72)
O66439 6.42e-28 99 56 0 80 3 rpsQ Small ribosomal subunit protein uS17 Aquifex aeolicus (strain VF5)
Q31IX3 8.03e-28 99 53 0 82 3 rpsQ Small ribosomal subunit protein uS17 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B7IHV5 8.57e-28 99 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Thermosipho africanus (strain TCF52B)
A9KD22 1.08e-27 99 62 0 78 3 rpsQ Small ribosomal subunit protein uS17 Coxiella burnetii (strain Dugway 5J108-111)
A6LLM2 1.11e-27 99 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B0K5Q2 1.15e-27 98 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Thermoanaerobacter sp. (strain X514)
B0KCK9 1.15e-27 98 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q63Q20 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia pseudomallei (strain K96243)
A3NEH0 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia pseudomallei (strain 668)
Q3JMS2 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia pseudomallei (strain 1710b)
A3P0A4 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia pseudomallei (strain 1106a)
A1V894 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia mallei (strain SAVP1)
Q62GL4 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia mallei (strain ATCC 23344)
A2S7I5 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia mallei (strain NCTC 10229)
A3MRW3 1.2e-27 98 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Burkholderia mallei (strain NCTC 10247)
A1WHD4 1.27e-27 98 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Verminephrobacter eiseniae (strain EF01-2)
C0ZW34 1.28e-27 98 67 0 73 3 rpsQ Small ribosomal subunit protein uS17 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B9MKH2 1.41e-27 98 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B1Y8H8 1.44e-27 98 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B1KSL6 1.44e-27 98 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ65 1.44e-27 98 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FMU2 1.44e-27 98 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Kyoto / Type A2)
A5I7J7 1.44e-27 98 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ60 1.44e-27 98 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain ATCC 19397 / Type A)
B1YGV9 1.47e-27 98 61 0 83 3 rpsQ Small ribosomal subunit protein uS17 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8R7W3 1.57e-27 98 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1AVK9 1.74e-27 98 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Ruthia magnifica subsp. Calyptogena magnifica
A4XBN7 1.91e-27 98 64 0 74 3 rpsQ Small ribosomal subunit protein uS17 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q13TH9 1.94e-27 98 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Paraburkholderia xenovorans (strain LB400)
B2T742 1.94e-27 98 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
C3KVP2 2.12e-27 97 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain 657 / Type Ba4)
Q8KAI1 2.33e-27 97 61 0 73 3 rpsQ Small ribosomal subunit protein uS17 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A4XLS1 3.21e-27 97 61 0 73 3 rpsQ Small ribosomal subunit protein uS17 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7HM43 3.28e-27 97 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B2TII4 3.62e-27 97 64 0 74 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYB9 4.04e-27 97 65 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium botulinum (strain Alaska E43 / Type E3)
A9BPS7 4.12e-27 97 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8A485 4.54e-27 97 60 0 73 3 rpsQ1 Small ribosomal subunit protein uS17A Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q97EI7 4.56e-27 97 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1I1J7 4.58e-27 97 56 1 79 3 rpsQ Small ribosomal subunit protein uS17 Desulforudis audaxviator (strain MP104C)
C0ZII9 4.77e-27 97 59 0 79 3 rpsQ Small ribosomal subunit protein uS17 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2L2B2 4.87e-27 97 53 0 82 3 rpsQ Small ribosomal subunit protein uS17 Bordetella avium (strain 197N)
A9IIY6 4.94e-27 97 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A9BH96 4.96e-27 97 54 1 84 3 rpsQ Small ribosomal subunit protein uS17 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q6MJ23 6.31e-27 96 60 0 73 3 rpsQ Small ribosomal subunit protein uS17 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q83ER7 7.2e-27 96 62 0 78 3 rpsQ Small ribosomal subunit protein uS17 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B3E7U4 7.34e-27 96 57 0 78 3 rpsQ Small ribosomal subunit protein uS17 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q47LK2 7.61e-27 96 60 0 74 3 rpsQ Small ribosomal subunit protein uS17 Thermobifida fusca (strain YX)
Q64NL7 7.94e-27 96 58 0 73 3 rpsQ Small ribosomal subunit protein uS17 Bacteroides fragilis (strain YCH46)
Q5L8B8 7.94e-27 96 58 0 73 3 rpsQ Small ribosomal subunit protein uS17 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q0VSJ4 8.95e-27 96 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B1W3Z8 9.24e-27 96 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A8F994 9.35e-27 96 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Bacillus pumilus (strain SAFR-032)
Q6A6N5 9.95e-27 96 60 0 74 1 rpsQ Small ribosomal subunit protein uS17 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q82DN6 1.04e-26 96 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q3API2 1.13e-26 96 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Chlorobium chlorochromatii (strain CaD3)
A1W2R6 1.36e-26 95 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Acidovorax sp. (strain JS42)
B9MB82 1.36e-26 95 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Acidovorax ebreus (strain TPSY)
Q9L0D1 1.57e-26 95 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9PE67 1.58e-26 95 51 0 78 3 rpsQ Small ribosomal subunit protein uS17 Xylella fastidiosa (strain 9a5c)
Q82X80 1.72e-26 95 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q21RW7 1.75e-26 95 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8XV21 1.87e-26 95 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7MTM2 1.89e-26 95 57 0 73 3 rpsQ Small ribosomal subunit protein uS17 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLY3 1.89e-26 95 57 0 73 3 rpsQ Small ribosomal subunit protein uS17 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q5Z1V4 2.11e-26 95 64 0 73 3 rpsQ Small ribosomal subunit protein uS17 Nocardia farcinica (strain IFM 10152)
Q3A9S5 2.4e-26 95 58 0 73 3 rpsQ Small ribosomal subunit protein uS17 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7VTC4 2.41e-26 95 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2E7 2.41e-26 95 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB6 2.41e-26 95 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A0QSE0 3.16e-26 95 61 0 77 1 rpsQ Small ribosomal subunit protein uS17 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q7UN11 3.43e-26 95 62 0 77 3 rpsQ Small ribosomal subunit protein uS17 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B0U5K8 3.68e-26 94 50 0 78 3 rpsQ Small ribosomal subunit protein uS17 Xylella fastidiosa (strain M12)
A6W5U7 4.1e-26 95 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q65P98 4.48e-26 94 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q18CG8 5.98e-26 94 63 0 72 3 rpsQ Small ribosomal subunit protein uS17 Clostridioides difficile (strain 630)
B8DNA5 6.19e-26 94 56 0 83 3 rpsQ Small ribosomal subunit protein uS17 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
P12874 6.29e-26 94 56 0 79 1 rpsQ Small ribosomal subunit protein uS17 Bacillus subtilis (strain 168)
Q0AII7 6.32e-26 94 51 0 80 3 rpsQ Small ribosomal subunit protein uS17 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q3B6F3 6.35e-26 94 54 0 77 3 rpsQ Small ribosomal subunit protein uS17 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q12GW2 6.58e-26 94 56 0 78 3 rpsQ Small ribosomal subunit protein uS17 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q88XX7 6.58e-26 94 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5P323 6.58e-26 94 54 1 86 3 rpsQ Small ribosomal subunit protein uS17 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1ALV0 6.75e-26 94 57 0 73 3 rpsQ Small ribosomal subunit protein uS17 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C6C194 7.8e-26 94 60 0 78 3 rpsQ Small ribosomal subunit protein uS17 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A5D5G4 8.19e-26 94 56 0 76 3 rpsQ Small ribosomal subunit protein uS17 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P51305 8.73e-26 94 56 0 73 3 rps17 Small ribosomal subunit protein uS17c Porphyra purpurea
Q04G76 9.19e-26 94 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B7GJ76 9.65e-26 94 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A7Z0P7 1.15e-25 93 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5N4Q6 1.26e-25 93 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYB8 1.26e-25 93 59 0 77 3 rpsQ Small ribosomal subunit protein uS17 Clostridium kluyveri (strain NBRC 12016)
A0PM72 1.43e-25 94 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Mycobacterium ulcerans (strain Agy99)
B2HSP0 1.58e-25 94 63 0 73 3 rpsQ Small ribosomal subunit protein uS17 Mycobacterium marinum (strain ATCC BAA-535 / M)
B1XSR0 1.69e-25 93 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4SUX0 1.69e-25 93 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2I8H8 1.77e-25 93 50 0 78 3 rpsQ Small ribosomal subunit protein uS17 Xylella fastidiosa (strain M23)
Q87E73 1.97e-25 93 50 0 78 3 rpsQ Small ribosomal subunit protein uS17 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A1VIQ9 1.97e-25 93 55 0 77 3 rpsQ Small ribosomal subunit protein uS17 Polaromonas naphthalenivorans (strain CJ2)
Q2W2K0 2.07e-25 92 59 0 71 3 rpsQ Small ribosomal subunit protein uS17 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1XDI3 2.39e-25 92 57 0 73 3 rps17 Small ribosomal subunit protein uS17c Neopyropia yezoensis
P23828 2.4e-25 92 58 0 75 1 rpsQ Small ribosomal subunit protein uS17 Geobacillus stearothermophilus
B8G1X5 3.13e-25 92 60 0 75 3 rpsQ Small ribosomal subunit protein uS17 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q8EUC2 3.44e-25 92 58 0 77 3 rpsQ Small ribosomal subunit protein uS17 Malacoplasma penetrans (strain HF-2)
A4FPL6 3.68e-25 92 59 1 81 3 rpsQ Small ribosomal subunit protein uS17 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
O32990 4.12e-25 93 61 0 73 3 rpsQ Small ribosomal subunit protein uS17 Mycobacterium leprae (strain TN)
Q2JFG7 4.38e-25 92 59 0 74 3 rpsQ Small ribosomal subunit protein uS17 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0LIJ9 4.47e-25 92 51 0 79 3 rpsQ Small ribosomal subunit protein uS17 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2N9C0 4.77e-25 92 60 0 70 3 rpsQ Small ribosomal subunit protein uS17 Erythrobacter litoralis (strain HTCC2594)
C5D3S6 4.78e-25 92 58 0 75 3 rpsQ Small ribosomal subunit protein uS17 Geobacillus sp. (strain WCH70)
Q2LQB1 5.27e-25 92 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Syntrophus aciditrophicus (strain SB)
Q1WS99 7.2e-25 91 53 0 79 3 rpsQ Small ribosomal subunit protein uS17 Ligilactobacillus salivarius (strain UCC118)
Q73SA5 7.55e-25 92 61 0 77 3 rpsQ Small ribosomal subunit protein uS17 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q67JV2 9.49e-25 91 54 0 77 3 rpsQ Small ribosomal subunit protein uS17 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B7GND1 1.15e-24 90 56 0 74 3 rpsQ Small ribosomal subunit protein uS17 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G409 1.15e-24 90 56 0 74 3 rpsQ Small ribosomal subunit protein uS17 Bifidobacterium longum (strain NCC 2705)
B3DQC3 1.15e-24 90 56 0 74 3 rpsQ Small ribosomal subunit protein uS17 Bifidobacterium longum (strain DJO10A)
Q30Z51 1.45e-24 90 57 0 78 3 rpsQ Small ribosomal subunit protein uS17 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1VEA7 1.48e-24 90 58 0 80 3 rpsQ Small ribosomal subunit protein uS17 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH1 1.48e-24 90 58 0 80 3 rpsQ Small ribosomal subunit protein uS17 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A5CXL3 1.57e-24 90 53 0 76 3 rpsQ Small ribosomal subunit protein uS17 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A5USI0 2.54e-24 90 56 1 72 3 rpsQ Small ribosomal subunit protein uS17 Roseiflexus sp. (strain RS-1)
A7NR54 2.65e-24 90 56 1 72 3 rpsQ Small ribosomal subunit protein uS17 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A4IJJ8 2.88e-24 90 58 0 75 3 rpsQ Small ribosomal subunit protein uS17 Geobacillus thermodenitrificans (strain NG80-2)
Q839F5 3.06e-24 90 53 0 79 1 rpsQ Small ribosomal subunit protein uS17 Enterococcus faecalis (strain ATCC 700802 / V583)
Q2RFQ6 3.34e-24 89 57 0 77 3 rpsQ Small ribosomal subunit protein uS17 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B5XJ45 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE79 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU0 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J905 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ53 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP08 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE49 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNP8 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DE78 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1W5 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M1
Q8E2C5 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7T2 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W0 3.64e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q250M3 3.98e-24 89 56 0 74 3 rpsQ Small ribosomal subunit protein uS17 Desulfitobacterium hafniense (strain Y51)
Q8DS22 4.25e-24 89 58 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P9WH51 4.45e-24 90 60 0 73 1 rpsQ Small ribosomal subunit protein uS17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH50 4.45e-24 90 60 0 73 3 rpsQ Small ribosomal subunit protein uS17 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O06051 4.45e-24 90 60 0 73 1 rpsQ Small ribosomal subunit protein uS17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q38US1 4.71e-24 89 53 0 79 3 rpsQ Small ribosomal subunit protein uS17 Latilactobacillus sakei subsp. sakei (strain 23K)
Q5L414 5.09e-24 89 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Geobacillus kaustophilus (strain HTA426)
A1A078 5.34e-24 89 58 0 74 3 rpsQ Small ribosomal subunit protein uS17 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q1MPQ5 5.83e-24 89 56 0 78 3 rpsQ Small ribosomal subunit protein uS17 Lawsonia intracellularis (strain PHE/MN1-00)
A5FZV6 5.96e-24 89 58 0 68 3 rpsQ Small ribosomal subunit protein uS17 Acidiphilium cryptum (strain JF-5)
Q8RIG4 6.69e-24 89 53 0 82 3 rpsQ Small ribosomal subunit protein uS17 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C4KZN7 6.87e-24 89 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q03ZN6 6.87e-24 89 51 0 79 3 rpsQ Small ribosomal subunit protein uS17 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
C4ZBS8 7.06e-24 89 54 0 77 3 rpsQ Small ribosomal subunit protein uS17 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q211F7 7.34e-24 89 56 0 76 3 rpsQ Small ribosomal subunit protein uS17 Rhodopseudomonas palustris (strain BisB18)
Q07KM7 7.34e-24 89 56 0 76 3 rpsQ Small ribosomal subunit protein uS17 Rhodopseudomonas palustris (strain BisA53)
Q1QN21 7.5e-24 89 56 0 76 3 rpsQ Small ribosomal subunit protein uS17 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q6MSN4 7.63e-24 89 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P10131 7.63e-24 89 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A0L5Y2 8.15e-24 89 55 0 70 3 rpsQ Small ribosomal subunit protein uS17 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q02W33 9.55e-24 88 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNP6 9.65e-24 88 54 0 79 1 rpsQ Small ribosomal subunit protein uS17 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDX1 9.65e-24 88 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Lactococcus lactis subsp. lactis (strain IL1403)
A2RC23 1.51e-23 88 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5XEC6 1.51e-23 88 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8NSZ7 1.55e-23 88 55 1 81 3 rpsQ Small ribosomal subunit protein uS17 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBJ1 1.55e-23 88 55 1 81 3 rpsQ Small ribosomal subunit protein uS17 Corynebacterium glutamicum (strain R)
Q0AUI9 1.68e-23 88 56 0 73 3 rpsQ Small ribosomal subunit protein uS17 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A8YXL4 1.74e-23 88 53 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus helveticus (strain DPC 4571)
Q83FZ5 1.78e-23 88 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Tropheryma whipplei (strain Twist)
Q83I69 1.78e-23 88 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Tropheryma whipplei (strain TW08/27)
B8DW22 2.01e-23 87 55 0 74 3 rpsQ Small ribosomal subunit protein uS17 Bifidobacterium animalis subsp. lactis (strain AD011)
A8F4S0 2.28e-23 88 51 0 77 3 rpsQ Small ribosomal subunit protein uS17 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q3SSV7 2.48e-23 87 56 0 72 3 rpsQ Small ribosomal subunit protein uS17 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q03IG0 3.25e-23 87 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B6JEU2 3.37e-23 87 56 0 72 3 rpsQ Small ribosomal subunit protein uS17 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B3QBX1 3.67e-23 87 56 0 72 3 rpsQ Small ribosomal subunit protein uS17 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U3 3.67e-23 87 56 0 72 1 rpsQ Small ribosomal subunit protein uS17 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5M2C2 3.84e-23 87 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXS0 3.84e-23 87 56 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus thermophilus (strain CNRZ 1066)
B5YG38 4.6e-23 87 50 0 77 3 rpsQ Small ribosomal subunit protein uS17 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q034Z2 5.3e-23 87 50 0 79 3 rpsQ Small ribosomal subunit protein uS17 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAK8 5.3e-23 87 50 0 79 3 rpsQ Small ribosomal subunit protein uS17 Lacticaseibacillus casei (strain BL23)
Q6F1Y5 5.78e-23 86 54 0 79 3 rpsQ Small ribosomal subunit protein uS17 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q11HR1 6.43e-23 86 56 0 71 3 rpsQ Small ribosomal subunit protein uS17 Chelativorans sp. (strain BNC1)
Q04C06 6.49e-23 86 53 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBK9 6.49e-23 86 53 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q9Z9K5 8.53e-23 86 56 0 75 3 rpsQ Small ribosomal subunit protein uS17 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3A6N8 9.41e-23 86 48 0 79 3 rpsQ Small ribosomal subunit protein uS17 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B5ZB49 9.63e-23 86 48 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q9PQQ1 9.63e-23 86 48 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIM9 9.63e-23 86 48 0 77 3 rpsQ Small ribosomal subunit protein uS17 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q2RQW9 1e-22 85 56 0 71 3 rpsQ Small ribosomal subunit protein uS17 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q74L80 1.07e-22 86 51 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046B6 1.07e-22 86 51 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B6IRR5 1.26e-22 85 56 0 71 3 rpsQ Small ribosomal subunit protein uS17 Rhodospirillum centenum (strain ATCC 51521 / SW)
A0ALV9 1.3e-22 85 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927L6 1.3e-22 85 57 0 75 1 rpsQ Small ribosomal subunit protein uS17 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB17 1.3e-22 85 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF5 1.3e-22 85 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Listeria monocytogenes serotype 4b (strain F2365)
C1KZH1 1.3e-22 85 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANU5 1.3e-22 85 57 0 75 3 rpsQ Small ribosomal subunit protein uS17 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8FS73 1.34e-22 85 54 1 79 3 rpsQ Small ribosomal subunit protein uS17 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O31164 1.73e-22 85 51 0 78 3 rpsQ Small ribosomal subunit protein uS17 Spiroplasma citri
C5CC53 1.91e-22 85 53 0 77 3 rpsQ Small ribosomal subunit protein uS17 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
C1CP97 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA6 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain P1031)
C1CC15 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain JJA)
A4VSG3 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus suis (strain 05ZYH33)
A3CK72 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus sanguinis (strain SK36)
A4VYQ2 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus suis (strain 98HAH33)
P0A4B4 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS49 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain CGSP14)
P0A4B3 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG6 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K7 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAM1 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae (strain 70585)
B5E6G4 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MM7 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8AZL6 1.98e-22 85 55 0 79 3 rpsQ Small ribosomal subunit protein uS17 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q5FM81 2e-22 85 51 0 76 3 rpsQ Small ribosomal subunit protein uS17 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B9DM38 2.06e-22 85 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Staphylococcus carnosus (strain TM300)
A4YSK1 2.19e-22 85 55 0 72 3 rpsQ Small ribosomal subunit protein uS17 Bradyrhizobium sp. (strain ORS 278)
A5ELL8 2.19e-22 85 55 0 72 3 rpsQ Small ribosomal subunit protein uS17 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q6YR12 2.27e-22 85 50 0 77 3 rpsQ Small ribosomal subunit protein uS17 Onion yellows phytoplasma (strain OY-M)
Q5FTZ2 2.28e-22 85 53 0 71 3 rpsQ Small ribosomal subunit protein uS17 Gluconobacter oxydans (strain 621H)
A7GK29 2.45e-22 85 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5NQ56 2.65e-22 85 57 1 77 3 rpsQ Small ribosomal subunit protein uS17 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q39XZ7 2.77e-22 85 50 0 76 3 rpsQ Small ribosomal subunit protein uS17 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9RXJ3 2.9e-22 85 51 0 76 3 rpsQ Small ribosomal subunit protein uS17 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A7HBM7 3.12e-22 84 54 0 73 3 rpsQ Small ribosomal subunit protein uS17 Anaeromyxobacter sp. (strain Fw109-5)
Q6HPP9 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H81 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain ZK / E33L)
B9IZK3 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain Q1)
B7HQV3 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain AH187)
B7HJ57 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain B4264)
C1ET48 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain 03BB102)
B7IT28 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain G9842)
Q73F87 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKC8 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus cereus (strain AH820)
Q81VS1 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus anthracis
A0R8I9 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus thuringiensis (strain Al Hakam)
C3LJ91 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R4 3.19e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus anthracis (strain A0248)
Q3ZZL5 3.21e-22 85 53 0 82 3 rpsQ Small ribosomal subunit protein uS17 Dehalococcoides mccartyi (strain CBDB1)
A5FRY4 3.21e-22 85 53 0 82 3 rpsQ Small ribosomal subunit protein uS17 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q8CRG8 3.84e-22 84 52 0 75 3 rpsQ Small ribosomal subunit protein uS17 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM08 3.84e-22 84 52 0 75 3 rpsQ Small ribosomal subunit protein uS17 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q89J93 3.91e-22 84 54 0 72 3 rpsQ Small ribosomal subunit protein uS17 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9VP86 4.01e-22 84 53 0 75 3 rpsQ Small ribosomal subunit protein uS17 Bacillus mycoides (strain KBAB4)
A5GVW9 4.25e-22 84 52 0 70 3 rpsQ Small ribosomal subunit protein uS17 Synechococcus sp. (strain RCC307)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18815
Feature type CDS
Gene rpsQ
Product 30S ribosomal protein S17
Location 18467 - 18721 (strand: -1)
Length 255 (nucleotides) / 84 (amino acids)
In genomic island -

Contig

Accession ZDB_385
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2423
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00366 Ribosomal protein S17

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0186 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S17

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02961 small subunit ribosomal protein S17 Ribosome -

Protein Sequence

MTDKIRTLQGRVVSDKMEKSIVVTIERMVKHPLYGKFIRRTTKLHVHDENNECGIGDVVEIRETRPLSKTKSWTLVRVVEKAVL

Flanking regions ( +/- flanking 50bp)

CGTAATATTGCACGTGTTAAGACTTTATTGACTGAGAAGGCGGGTGCGTAATGACCGATAAAATCCGTACTCTGCAAGGTCGTGTTGTTAGTGACAAAATGGAGAAATCCATTGTTGTGACTATCGAGCGTATGGTGAAACACCCTCTGTATGGTAAGTTCATCCGTCGTACGACTAAACTGCACGTACATGACGAGAACAATGAATGTGGTATCGGTGACGTGGTAGAAATCCGCGAAACCCGTCCACTGTCTAAGACTAAGTCCTGGACCCTGGTTCGCGTCGTAGAGAAAGCTGTACTGTAACAGCACTGCTTTCTGATGTAGAATAAACGGCTCGGCTTTAGAGCCGTTTA