Homologs in group_2417

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19170 FBDBKF_19170 100.0 Morganella morganii S1 rplF 50S ribosomal protein L6
EHELCC_18915 EHELCC_18915 100.0 Morganella morganii S2 rplF 50S ribosomal protein L6
NLDBIP_18930 NLDBIP_18930 100.0 Morganella morganii S4 rplF 50S ribosomal protein L6
HKOGLL_18520 HKOGLL_18520 100.0 Morganella morganii S5 rplF 50S ribosomal protein L6
F4V73_RS18995 F4V73_RS18995 97.2 Morganella psychrotolerans rplF 50S ribosomal protein L6
PMI_RS16225 PMI_RS16225 89.3 Proteus mirabilis HI4320 rplF 50S ribosomal protein L6

Distribution of the homologs in the orthogroup group_2417

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2417

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1J9 1.98e-118 335 89 0 177 3 rplF Large ribosomal subunit protein uL6 Proteus mirabilis (strain HI4320)
Q7MYG6 1.71e-115 327 87 0 177 3 rplF Large ribosomal subunit protein uL6 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5XNA8 3.26e-115 327 87 0 177 3 rplF Large ribosomal subunit protein uL6 Klebsiella pneumoniae (strain 342)
B7LRS1 2.86e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6CZY5 3.34e-114 324 87 0 177 3 rplF Large ribosomal subunit protein uL6 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0AG58 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella flexneri
Q0SZZ7 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella flexneri serotype 5b (strain 8401)
Q32B46 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX1 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella boydii serotype 4 (strain Sb227)
B2U2S3 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R624 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain UTI89 / UPEC)
B1LHB9 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain SMS-3-5 / SECEC)
B6I219 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain SE11)
B7NDS6 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG55 3.49e-114 324 85 0 177 1 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain K12)
B1IPZ4 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AG56 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF6 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ4 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O1:K1 / APEC
A8A5B0 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O9:H4 (strain HS)
B1X6F7 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain K12 / DH10B)
C4ZUG0 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1L9 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O8 (strain IAI1)
B7N189 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O81 (strain ED1a)
B7NLM4 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTM6 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG57 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O157:H7
B7LI04 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli (strain 55989 / EAEC)
B7MCS0 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK29 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ4 3.49e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Escherichia coli O139:H28 (strain E24377A / ETEC)
P66313 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66314 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella typhi
B4TXC7 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella schwarzengrund (strain CVM19633)
B5BGX1 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella paratyphi A (strain AKU_12601)
C0PZW8 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella paratyphi C (strain RKS4594)
A9MSY3 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU8 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUS5 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella newport (strain SL254)
B4TJZ4 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella heidelberg (strain SL476)
B5RH30 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1G2 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella enteritidis PT4 (strain P125109)
Q57J47 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella choleraesuis (strain SC-B67)
B5F7T0 3.53e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella agona (strain SL483)
A8AQK0 3.85e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C5BGL0 3.89e-114 324 85 0 177 3 rplF Large ribosomal subunit protein uL6 Edwardsiella ictaluri (strain 93-146)
A7MPG5 6.59e-114 323 85 0 177 3 rplF Large ribosomal subunit protein uL6 Cronobacter sakazakii (strain ATCC BAA-894)
A6TEV7 1.18e-113 323 85 0 177 3 rplF Large ribosomal subunit protein uL6 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MN63 1.83e-113 322 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3YWV4 2.06e-113 322 84 0 177 3 rplF Large ribosomal subunit protein uL6 Shigella sonnei (strain Ss046)
B5FJJ9 2.2e-113 322 85 0 177 3 rplF Large ribosomal subunit protein uL6 Salmonella dublin (strain CT_02021853)
A8GKI2 3.38e-113 322 86 0 177 3 rplF Large ribosomal subunit protein uL6 Serratia proteamaculans (strain 568)
C6DG59 3.49e-113 322 87 0 177 3 rplF Large ribosomal subunit protein uL6 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VK81 7.95e-113 321 85 0 177 3 rplF Large ribosomal subunit protein uL6 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JS15 1.75e-112 320 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JIX6 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T6 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH07 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pestis (strain Pestoides F)
Q1CCV9 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R910 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pestis bv. Antiqua (strain Angola)
Q7CFT4 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pestis
B2K522 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2W2 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL9 4.5e-112 319 85 0 177 3 rplF Large ribosomal subunit protein uL6 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WFB3 5.92e-112 318 84 0 177 3 rplF Large ribosomal subunit protein uL6 Enterobacter sp. (strain 638)
Q2NQN7 2.14e-111 317 83 0 177 3 rplF Large ribosomal subunit protein uL6 Sodalis glossinidius (strain morsitans)
P46181 1.12e-108 310 84 0 177 3 rplF Large ribosomal subunit protein uL6 Buchnera aphidicola subsp. Acyrthosiphon kondoi
Q9CL45 1.7e-105 302 81 0 177 3 rplF Large ribosomal subunit protein uL6 Pasteurella multocida (strain Pm70)
Q65QX0 4.33e-104 299 79 0 177 3 rplF Large ribosomal subunit protein uL6 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I147 1.14e-101 293 77 0 177 3 rplF Large ribosomal subunit protein uL6 Histophilus somni (strain 129Pt)
A6VLK3 1.76e-101 292 77 0 177 3 rplF Large ribosomal subunit protein uL6 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UX29 2.22e-101 292 77 0 177 3 rplF Large ribosomal subunit protein uL6 Histophilus somni (strain 2336)
B0BSU6 2.7e-101 291 79 0 177 3 rplF Large ribosomal subunit protein uL6 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ26 2.7e-101 291 79 0 177 3 rplF Large ribosomal subunit protein uL6 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N372 2.7e-101 291 79 0 177 3 rplF Large ribosomal subunit protein uL6 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P44347 1.42e-100 290 76 0 177 3 rplF Large ribosomal subunit protein uL6 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHU6 1.42e-100 290 76 0 177 3 rplF Large ribosomal subunit protein uL6 Haemophilus influenzae (strain PittGG)
A5UDT2 1.42e-100 290 76 0 177 3 rplF Large ribosomal subunit protein uL6 Haemophilus influenzae (strain PittEE)
Q4QMA6 1.42e-100 290 76 0 177 3 rplF Large ribosomal subunit protein uL6 Haemophilus influenzae (strain 86-028NP)
Q7VKE8 7.1e-100 288 76 0 177 3 rplF Large ribosomal subunit protein uL6 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F6Q6 1.92e-99 287 76 0 177 3 rplF Large ribosomal subunit protein uL6 Glaesserella parasuis serovar 5 (strain SH0165)
Q7MPH3 2.64e-96 279 75 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio vulnificus (strain YJ016)
Q8DE55 2.64e-96 279 75 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio vulnificus (strain CMCP6)
C3LRP3 3.25e-96 279 76 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ9 3.25e-96 279 76 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B5FG24 1.09e-94 275 73 0 177 3 rplF Large ribosomal subunit protein uL6 Aliivibrio fischeri (strain MJ11)
Q5E899 1.59e-94 275 72 0 177 3 rplF Large ribosomal subunit protein uL6 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EPU0 2.05e-94 274 72 0 177 3 rplF Large ribosomal subunit protein uL6 Aliivibrio salmonicida (strain LFI1238)
A5F565 2.98e-94 274 74 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87SZ8 5.94e-94 273 71 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWH2 8.07e-94 273 71 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio campbellii (strain ATCC BAA-1116)
B7VLE2 1.46e-93 272 71 0 177 3 rplF Large ribosomal subunit protein uL6 Vibrio atlanticus (strain LGP32)
Q6LVA1 2.7e-93 271 74 0 177 3 rplF Large ribosomal subunit protein uL6 Photobacterium profundum (strain SS9)
C4K7A3 5.09e-93 271 69 0 177 3 rplF Large ribosomal subunit protein uL6 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A0KF36 3.28e-91 266 72 0 177 3 rplF Large ribosomal subunit protein uL6 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SSZ1 2.93e-90 264 71 0 177 3 rplF Large ribosomal subunit protein uL6 Aeromonas salmonicida (strain A449)
C4L7U5 5.34e-87 255 70 0 177 3 rplF Large ribosomal subunit protein uL6 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3IJK0 2.12e-86 254 66 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudoalteromonas translucida (strain TAC 125)
Q089N9 7.48e-86 253 68 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella frigidimarina (strain NCIMB 400)
A1S233 3.14e-84 248 68 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12SU4 9.59e-84 247 68 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8K964 6.6e-83 245 63 1 178 3 rplF Large ribosomal subunit protein uL6 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9KWB7 1.65e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella baltica (strain OS195)
A6WHU3 1.65e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella baltica (strain OS185)
A3DA57 1.65e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ0 1.65e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella baltica (strain OS223)
A1REC9 2.48e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella sp. (strain W3-18-1)
A4YBW8 2.48e-82 244 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KRN9 3.41e-82 243 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella sp. (strain ANA-3)
Q0I090 7.42e-82 243 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella sp. (strain MR-7)
Q0HNS2 7.42e-82 243 67 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella sp. (strain MR-4)
A4XZ75 8.18e-82 242 64 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas mendocina (strain ymp)
P57576 1.48e-81 242 61 1 178 3 rplF Large ribosomal subunit protein uL6 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q15X58 2.17e-81 241 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8EK54 4.33e-81 241 66 0 177 3 rplF Large ribosomal subunit protein uL6 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A6W377 1.05e-80 239 62 0 177 3 rplF Large ribosomal subunit protein uL6 Marinomonas sp. (strain MWYL1)
B3PK52 2.55e-80 239 65 0 177 3 rplF Large ribosomal subunit protein uL6 Cellvibrio japonicus (strain Ueda107)
Q5QXW0 5.08e-80 238 63 0 177 3 rplF Large ribosomal subunit protein uL6 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B4RT43 1.06e-79 237 61 0 177 3 rplF Large ribosomal subunit protein uL6 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q2S927 1.13e-79 237 62 0 177 3 rplF Large ribosomal subunit protein uL6 Hahella chejuensis (strain KCTC 2396)
Q1IFV1 1.44e-79 237 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas entomophila (strain L48)
B1JAJ7 2.63e-79 236 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas putida (strain W619)
Q31IW7 2.93e-79 236 61 0 177 3 rplF Large ribosomal subunit protein uL6 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1TYL2 4.96e-79 235 64 0 177 3 rplF Large ribosomal subunit protein uL6 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q88QM0 6.24e-79 235 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK82 6.24e-79 235 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas putida (strain GB-1)
A5VXR2 6.24e-79 235 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A8GYZ1 7.6e-79 235 66 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A4VHP5 8.12e-79 235 62 0 177 3 rplF Large ribosomal subunit protein uL6 Stutzerimonas stutzeri (strain A1501)
B0TLZ7 1.86e-78 234 66 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella halifaxensis (strain HAW-EB4)
Q4ZMQ9 2.68e-78 233 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas syringae pv. syringae (strain B728a)
B8CNE8 4.15e-78 233 66 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q3K603 5.22e-78 233 62 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas fluorescens (strain Pf0-1)
C3K2W1 6.09e-78 233 62 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas fluorescens (strain SBW25)
A3Q997 6.57e-78 233 64 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0V6W0 6.79e-78 233 61 0 177 3 rplF Large ribosomal subunit protein uL6 Acinetobacter baumannii (strain AYE)
A3M969 6.79e-78 233 61 0 177 3 rplF Large ribosomal subunit protein uL6 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7IA24 6.79e-78 233 61 0 177 1 rplF Large ribosomal subunit protein uL6 Acinetobacter baumannii (strain AB0057)
B7GW17 6.79e-78 233 61 0 177 3 rplF Large ribosomal subunit protein uL6 Acinetobacter baumannii (strain AB307-0294)
Q9HWF0 8.64e-78 232 63 0 177 1 rplF Large ribosomal subunit protein uL6 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T65 8.64e-78 232 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V659 8.64e-78 232 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas aeruginosa (strain LESB58)
A6UZK3 8.64e-78 232 63 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas aeruginosa (strain PA7)
Q4K548 9.23e-78 232 62 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7NQG7 1.08e-77 232 63 0 177 3 rplF Large ribosomal subunit protein uL6 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q889V6 3.11e-77 231 62 0 177 3 rplF Large ribosomal subunit protein uL6 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0VQT3 3.59e-77 231 61 0 177 3 rplF Large ribosomal subunit protein uL6 Acinetobacter baumannii (strain SDF)
Q21M43 5.04e-77 230 62 0 177 3 rplF Large ribosomal subunit protein uL6 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6F7S7 1.38e-76 229 60 0 177 3 rplF Large ribosomal subunit protein uL6 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q48D51 1.56e-76 229 62 1 179 3 rplF Large ribosomal subunit protein uL6 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C5BQ76 2.9e-76 228 61 0 177 3 rplF Large ribosomal subunit protein uL6 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B1KMW8 9.78e-76 227 64 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella woodyi (strain ATCC 51908 / MS32)
A1T0C7 1.2e-75 227 61 0 177 3 rplF Large ribosomal subunit protein uL6 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0VSI8 1.08e-74 224 59 0 177 3 rplF Large ribosomal subunit protein uL6 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A8G1D3 1.54e-74 224 63 1 177 3 rplF Large ribosomal subunit protein uL6 Shewanella sediminis (strain HAW-EB3)
Q488Z8 2.05e-74 224 61 0 177 3 rplF Large ribosomal subunit protein uL6 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1WVA7 4.23e-74 223 59 0 177 3 rplF Large ribosomal subunit protein uL6 Halorhodospira halophila (strain DSM 244 / SL1)
Q9K1I3 4.77e-74 223 59 0 177 1 rplF Large ribosomal subunit protein uL6 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A5WCK5 7.3e-74 222 59 0 177 3 rplF Large ribosomal subunit protein uL6 Psychrobacter sp. (strain PRwf-1)
Q9JX14 8.24e-74 222 59 0 177 3 rplF Large ribosomal subunit protein uL6 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F5U2 1.09e-73 222 59 0 177 3 rplF Large ribosomal subunit protein uL6 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KRI8 5.53e-73 220 58 0 177 3 rplF Large ribosomal subunit protein uL6 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M3V1 5.53e-73 220 58 0 177 3 rplF Large ribosomal subunit protein uL6 Neisseria meningitidis serogroup C (strain 053442)
Q1R0G0 8.66e-73 219 59 1 177 3 rplF Large ribosomal subunit protein uL6 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8GV43 1.39e-72 219 57 0 177 3 rplF Large ribosomal subunit protein uL6 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1KB12 2.01e-72 219 62 0 177 3 rplF Large ribosomal subunit protein uL6 Azoarcus sp. (strain BH72)
Q1QDH1 2.7e-72 218 59 0 177 3 rplF Large ribosomal subunit protein uL6 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A4G9S3 4.5e-71 215 57 0 177 3 rplF Large ribosomal subunit protein uL6 Herminiimonas arsenicoxydans
Q4FUE1 5.42e-71 215 58 0 177 3 rplF Large ribosomal subunit protein uL6 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0ABG0 2.54e-70 213 59 0 177 3 rplF Large ribosomal subunit protein uL6 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5P317 3.16e-70 213 58 0 177 3 rplF Large ribosomal subunit protein uL6 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3SLN4 9.22e-70 212 60 1 177 3 rplF Large ribosomal subunit protein uL6 Thiobacillus denitrificans (strain ATCC 25259)
A4SUX6 1.21e-69 211 56 0 177 3 rplF Large ribosomal subunit protein uL6 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
C1DAT2 1.65e-69 211 57 0 177 3 rplF Large ribosomal subunit protein uL6 Laribacter hongkongensis (strain HLHK9)
B1XSR6 2.36e-69 211 56 0 177 3 rplF Large ribosomal subunit protein uL6 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A2SLE2 3.21e-69 211 58 0 177 3 rplF Large ribosomal subunit protein uL6 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B1Y8C2 1.1e-68 209 57 0 177 3 rplF Large ribosomal subunit protein uL6 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q47J88 1.32e-68 209 60 1 177 3 rplF Large ribosomal subunit protein uL6 Dechloromonas aromatica (strain RCB)
A9IHT3 1.64e-68 209 59 0 177 3 rplF Large ribosomal subunit protein uL6 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1LI52 2.59e-68 208 59 0 177 3 rplF Large ribosomal subunit protein uL6 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A5EXA3 2.74e-68 208 55 0 177 3 rplF Large ribosomal subunit protein uL6 Dichelobacter nodosus (strain VCS1703A)
A6T3I9 3.16e-68 208 55 0 177 3 rplF Large ribosomal subunit protein uL6 Janthinobacterium sp. (strain Marseille)
Q0K634 1.74e-67 206 58 0 177 3 rplF Large ribosomal subunit protein uL6 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q89A80 1.92e-67 206 54 2 179 3 rplF Large ribosomal subunit protein uL6 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2L270 3.5e-67 205 57 0 177 3 rplF Large ribosomal subunit protein uL6 Bordetella avium (strain 197N)
A1W323 5.85e-67 205 57 0 177 3 rplF Large ribosomal subunit protein uL6 Acidovorax sp. (strain JS42)
B9MBV2 5.85e-67 205 57 0 177 3 rplF Large ribosomal subunit protein uL6 Acidovorax ebreus (strain TPSY)
B3R7F3 6.82e-67 204 57 0 177 3 rplF Large ribosomal subunit protein uL6 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46WF9 7.21e-67 204 57 0 177 3 rplF Large ribosomal subunit protein uL6 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7W2E0 8.31e-67 204 58 0 177 3 rplF Large ribosomal subunit protein uL6 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRA8 8.31e-67 204 58 0 177 3 rplF Large ribosomal subunit protein uL6 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1AVL5 2.15e-66 203 53 1 181 3 rplF Large ribosomal subunit protein uL6 Ruthia magnifica subsp. Calyptogena magnifica
Q7VTB6 2.45e-66 203 58 0 177 3 rplF Large ribosomal subunit protein uL6 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B2UEK4 3.44e-66 203 55 0 177 3 rplF Large ribosomal subunit protein uL6 Ralstonia pickettii (strain 12J)
A9BRW6 4.83e-66 202 55 0 177 3 rplF Large ribosomal subunit protein uL6 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q605C7 5.88e-66 202 58 0 177 3 rplF Large ribosomal subunit protein uL6 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8XV27 1.28e-65 201 55 0 177 3 rplF Large ribosomal subunit protein uL6 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1H4M2 2.26e-65 201 57 0 177 3 rplF Large ribosomal subunit protein uL6 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1TJT2 3.38e-65 200 56 0 177 3 rplF Large ribosomal subunit protein uL6 Paracidovorax citrulli (strain AAC00-1)
B2JI50 4.12e-65 200 57 1 177 3 rplF Large ribosomal subunit protein uL6 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2SU42 1.67e-64 198 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A9ADK8 3.63e-64 197 56 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia multivorans (strain ATCC 17616 / 249)
B5ELZ4 4.1e-64 197 57 1 177 3 rplF Large ribosomal subunit protein uL6 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J482 4.1e-64 197 57 1 177 3 rplF Large ribosomal subunit protein uL6 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A5CXL9 5.79e-64 197 50 1 181 3 rplF Large ribosomal subunit protein uL6 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A0Q4J8 8.06e-64 197 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. novicida (strain U112)
Q13TI5 9.19e-64 197 56 1 177 3 rplF Large ribosomal subunit protein uL6 Paraburkholderia xenovorans (strain LB400)
Q2YAY2 9.71e-64 197 54 0 177 3 rplF Large ribosomal subunit protein uL6 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5NHV3 1.23e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JA5 1.23e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BNR2 1.81e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5F5 1.81e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U0 1.81e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B2SDX0 2.74e-63 196 52 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q63Q26 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia pseudomallei (strain K96243)
A3NEG4 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia pseudomallei (strain 668)
Q3JMS8 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia pseudomallei (strain 1710b)
A3P098 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia pseudomallei (strain 1106a)
A1V888 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia mallei (strain SAVP1)
Q62GM0 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia mallei (strain ATCC 23344)
A2S7J1 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia mallei (strain NCTC 10229)
A3MRW9 3.06e-63 195 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia mallei (strain NCTC 10247)
B2T736 5.46e-63 194 56 1 177 3 rplF Large ribosomal subunit protein uL6 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q1BRW3 7.67e-63 194 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia orbicola (strain AU 1054)
B1JU37 7.67e-63 194 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia orbicola (strain MC0-3)
B4E5D5 7.67e-63 194 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3P0 7.67e-63 194 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia cenocepacia (strain HI2424)
Q0BJ31 8.37e-63 194 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5WZJ7 1.05e-62 194 55 1 179 3 rplF Large ribosomal subunit protein uL6 Legionella pneumophila (strain Lens)
Q5ZYM8 1.05e-62 194 55 1 179 3 rplF Large ribosomal subunit protein uL6 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP9 1.05e-62 194 55 1 179 3 rplF Large ribosomal subunit protein uL6 Legionella pneumophila (strain Corby)
Q5X844 1.05e-62 194 55 1 179 3 rplF Large ribosomal subunit protein uL6 Legionella pneumophila (strain Paris)
B1YRP4 1.61e-62 193 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia ambifaria (strain MC40-6)
Q39KF2 1.9e-62 193 55 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C5CQ85 4.6e-62 192 55 0 177 3 rplF Large ribosomal subunit protein uL6 Variovorax paradoxus (strain S110)
A4IZR9 4.85e-62 192 51 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella tularensis subsp. tularensis (strain WY96-3418)
A4JAQ5 9.68e-62 191 54 1 177 3 rplF Large ribosomal subunit protein uL6 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B0U0X4 1.09e-61 191 50 1 178 3 rplF Large ribosomal subunit protein uL6 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B0UHV4 4.14e-61 190 53 0 177 3 rplF Large ribosomal subunit protein uL6 Methylobacterium sp. (strain 4-46)
Q83ER1 9.3e-60 186 54 0 177 3 rplF Large ribosomal subunit protein uL6 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY5 9.3e-60 186 54 0 177 3 rplF Large ribosomal subunit protein uL6 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD16 9.3e-60 186 54 0 177 3 rplF Large ribosomal subunit protein uL6 Coxiella burnetii (strain Dugway 5J108-111)
B6J5E7 9.3e-60 186 54 0 177 3 rplF Large ribosomal subunit protein uL6 Coxiella burnetii (strain CbuK_Q154)
Q3J8S9 5.7e-59 184 54 1 178 3 rplF Large ribosomal subunit protein uL6 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A1VJ30 9.64e-59 184 55 0 166 3 rplF Large ribosomal subunit protein uL6 Polaromonas naphthalenivorans (strain CJ2)
B6J248 9.74e-59 184 54 0 177 3 rplF Large ribosomal subunit protein uL6 Coxiella burnetii (strain CbuG_Q212)
A9IW07 1.43e-58 183 49 0 177 3 rplF Large ribosomal subunit protein uL6 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q21QN8 2.72e-58 183 54 0 166 3 rplF Large ribosomal subunit protein uL6 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B8ISA0 3.62e-58 182 50 0 177 3 rplF Large ribosomal subunit protein uL6 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q6FZD7 3.7e-58 182 49 0 177 3 rplF Large ribosomal subunit protein uL6 Bartonella quintana (strain Toulouse)
C0ZIJ5 5.59e-58 182 50 0 176 3 rplF Large ribosomal subunit protein uL6 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q6G2Y0 6.04e-58 182 48 0 177 3 rplF Large ribosomal subunit protein uL6 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q12G88 8.85e-58 181 53 0 166 3 rplF Large ribosomal subunit protein uL6 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6X0D3 9.25e-58 181 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B4R8N2 2.94e-57 180 49 0 177 3 rplF Large ribosomal subunit protein uL6 Phenylobacterium zucineum (strain HLK1)
A4J126 6.78e-57 179 50 0 170 3 rplF Large ribosomal subunit protein uL6 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q839E9 8.2e-57 179 50 0 175 1 rplF Large ribosomal subunit protein uL6 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8ETW8 8.38e-57 179 50 0 175 3 rplF Large ribosomal subunit protein uL6 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8G087 1.2e-56 179 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella suis biovar 1 (strain 1330)
B0CH17 1.2e-56 179 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQZ1 1.2e-56 179 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0RJI6 1.2e-56 179 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N5 1.2e-56 179 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B8H4E9 1.23e-56 179 53 0 177 3 rplF Large ribosomal subunit protein uL6 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8T8 1.23e-56 179 53 0 177 3 rplF Large ribosomal subunit protein uL6 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8YHM5 1.46e-56 178 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A0L5Y8 2.37e-56 178 49 0 177 3 rplF Large ribosomal subunit protein uL6 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B0T2D7 2.47e-56 178 51 0 177 3 rplF Large ribosomal subunit protein uL6 Caulobacter sp. (strain K31)
A1USQ9 2.76e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q57CS3 3.36e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella abortus biovar 1 (strain 9-941)
Q2YRB0 3.36e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella abortus (strain 2308)
B2S664 3.36e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Brucella abortus (strain S19)
Q1QN15 3.4e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SSV1 4.46e-56 177 49 0 177 3 rplF Large ribosomal subunit protein uL6 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q211G3 5.55e-56 177 48 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain BisB18)
Q3BWW8 1.22e-55 176 51 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q749A2 2.72e-55 175 48 0 175 3 rplF Large ribosomal subunit protein uL6 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P02391 5.73e-55 174 50 0 175 1 rplF Large ribosomal subunit protein uL6 Geobacillus stearothermophilus
Q5L408 5.73e-55 174 50 0 175 1 rplF Large ribosomal subunit protein uL6 Geobacillus kaustophilus (strain HTA426)
A7HWS6 6.4e-55 174 48 0 177 3 rplF Large ribosomal subunit protein uL6 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B2IK77 7.54e-55 174 49 0 177 3 rplF Large ribosomal subunit protein uL6 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A9W4S5 9.07e-55 174 48 0 177 3 rplF Large ribosomal subunit protein uL6 Methylorubrum extorquens (strain PA1)
B7L0T5 9.07e-55 174 48 0 177 3 rplF Large ribosomal subunit protein uL6 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A4YSK7 9.27e-55 174 47 0 177 3 rplF Large ribosomal subunit protein uL6 Bradyrhizobium sp. (strain ORS 278)
Q6F1X9 9.75e-55 174 46 1 176 3 rplF Large ribosomal subunit protein uL6 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
A8LM72 1e-54 174 47 0 177 3 rplF Large ribosomal subunit protein uL6 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q97EJ3 1.05e-54 174 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q16AC9 1.86e-54 173 49 0 177 3 rplF Large ribosomal subunit protein uL6 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A5ELL2 2.98e-54 172 46 0 177 3 rplF Large ribosomal subunit protein uL6 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B3QBW5 3.08e-54 172 48 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U8 3.08e-54 172 48 0 177 1 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A7Z0Q3 3.21e-54 172 52 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8Y444 3.74e-54 172 49 0 175 1 rplF Large ribosomal subunit protein uL6 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB23 3.74e-54 172 49 0 175 3 rplF Large ribosomal subunit protein uL6 Listeria monocytogenes serotype 4a (strain HCC23)
A5N4R2 4.4e-54 172 47 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYC4 4.4e-54 172 47 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium kluyveri (strain NBRC 12016)
B1Z778 4.56e-54 172 48 0 177 3 rplF Large ribosomal subunit protein uL6 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q2IXP5 5.03e-54 172 48 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain HaA2)
Q28UT9 5.09e-54 172 46 0 177 3 rplF Large ribosomal subunit protein uL6 Jannaschia sp. (strain CCS1)
Q18CH5 5.18e-54 172 47 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridioides difficile (strain 630)
Q07KN3 6.47e-54 172 48 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain BisA53)
Q5GWU9 1.12e-53 171 49 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P000 1.12e-53 171 49 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2RQX5 1.17e-53 171 48 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q134U4 1.3e-53 171 47 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodopseudomonas palustris (strain BisB5)
A0ALV3 1.62e-53 171 49 0 175 3 rplF Large ribosomal subunit protein uL6 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927M2 1.62e-53 171 49 0 175 3 rplF Large ribosomal subunit protein uL6 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q88XX1 1.65e-53 171 52 2 176 3 rplF Large ribosomal subunit protein uL6 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q71WG1 1.71e-53 171 49 0 175 3 rplF Large ribosomal subunit protein uL6 Listeria monocytogenes serotype 4b (strain F2365)
C1KZG5 1.71e-53 171 49 0 175 3 rplF Large ribosomal subunit protein uL6 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5WLP7 2.45e-53 170 49 0 175 3 rplF Large ribosomal subunit protein uL6 Shouchella clausii (strain KSM-K16)
A4XLR5 2.65e-53 170 49 0 171 3 rplF Large ribosomal subunit protein uL6 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A9H3L8 2.88e-53 170 48 0 177 3 rplF Large ribosomal subunit protein uL6 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q3A9T1 3.12e-53 170 47 0 170 3 rplF Large ribosomal subunit protein uL6 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q89J99 3.29e-53 170 48 0 177 3 rplF Large ribosomal subunit protein uL6 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8PC37 3.34e-53 170 49 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU67 3.34e-53 170 49 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas campestris pv. campestris (strain B100)
Q4URF4 3.34e-53 170 49 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas campestris pv. campestris (strain 8004)
Q3A6N2 4.55e-53 169 47 1 171 3 rplF Large ribosomal subunit protein uL6 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3J5Q7 5.74e-53 169 47 0 177 3 rplF Large ribosomal subunit protein uL6 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGM6 5.74e-53 169 47 0 177 3 rplF Large ribosomal subunit protein uL6 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WVJ3 7.87e-53 169 46 0 177 3 rplF Large ribosomal subunit protein uL6 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1B042 9.37e-53 169 47 0 177 3 rplF Large ribosomal subunit protein uL6 Paracoccus denitrificans (strain Pd 1222)
B5EFR5 9.97e-53 169 46 0 175 3 rplF Large ribosomal subunit protein uL6 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8PNR2 1.04e-52 169 50 1 176 3 rplF Large ribosomal subunit protein uL6 Xanthomonas axonopodis pv. citri (strain 306)
Q034Z8 1.15e-52 168 50 2 176 3 rplF Large ribosomal subunit protein uL6 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAK3 1.15e-52 168 50 2 176 3 rplF Large ribosomal subunit protein uL6 Lacticaseibacillus casei (strain BL23)
B9M6G3 1.53e-52 168 44 0 175 3 rplF Large ribosomal subunit protein uL6 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A6TWG7 1.96e-52 168 48 1 176 3 rplF Large ribosomal subunit protein uL6 Alkaliphilus metalliredigens (strain QYMF)
Q1GK14 2.03e-52 168 47 0 177 3 rplF Large ribosomal subunit protein uL6 Ruegeria sp. (strain TM1040)
Q11HR7 2.73e-52 167 46 0 177 3 rplF Large ribosomal subunit protein uL6 Chelativorans sp. (strain BNC1)
B2FQJ9 3.2e-52 167 48 3 184 3 rplF Large ribosomal subunit protein uL6 Stenotrophomonas maltophilia (strain K279a)
B1YGW5 4.08e-52 167 47 2 176 3 rplF Large ribosomal subunit protein uL6 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q67JV8 4.36e-52 167 48 0 175 3 rplF Large ribosomal subunit protein uL6 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9MKG6 4.57e-52 167 49 0 171 3 rplF Large ribosomal subunit protein uL6 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B6JEY0 4.61e-52 167 47 0 177 3 rplF Large ribosomal subunit protein uL6 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A7GJ59 4.95e-52 167 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q98N42 5.31e-52 167 47 0 177 3 rplF Large ribosomal subunit protein uL6 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q65P92 5.66e-52 167 49 0 175 3 rplF Large ribosomal subunit protein uL6 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B8ELE8 9.16e-52 166 47 0 177 3 rplF Large ribosomal subunit protein uL6 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1KSL0 1.06e-51 166 47 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Loch Maree / Type A3)
Q6AD09 1.07e-51 166 46 0 175 3 rplF Large ribosomal subunit protein uL6 Leifsonia xyli subsp. xyli (strain CTCB07)
B1IGD9 1.36e-51 166 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Okra / Type B1)
C1FMT6 1.36e-51 166 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Kyoto / Type A2)
A5I7J1 1.36e-51 166 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ54 1.36e-51 166 48 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain ATCC 19397 / Type A)
P46898 1.78e-51 166 50 1 176 1 rplF Large ribosomal subunit protein uL6 Bacillus subtilis (strain 168)
Q03ED1 1.86e-51 166 47 0 175 3 rplF Large ribosomal subunit protein uL6 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q6HPP3 1.94e-51 166 51 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H75 1.94e-51 166 51 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus cereus (strain ZK / E33L)
Q81J27 1.94e-51 166 51 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73F81 1.94e-51 166 51 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VR5 1.94e-51 166 51 1 176 3 rplF Large ribosomal subunit protein uL6 Bacillus anthracis
C3KVN6 2.2e-51 165 47 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain 657 / Type Ba4)
A5GAV7 2.26e-51 165 44 0 175 3 rplF Large ribosomal subunit protein uL6 Geotalea uraniireducens (strain Rf4)
Q97SU7 2.44e-51 165 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B7IHW1 3.27e-51 165 44 1 183 3 rplF Large ribosomal subunit protein uL6 Thermosipho africanus (strain TCF52B)
A1R8T1 3.28e-51 165 45 0 175 3 rplF Large ribosomal subunit protein uL6 Paenarthrobacter aurescens (strain TC1)
B1LWR1 3.28e-51 165 46 0 177 3 rplF Large ribosomal subunit protein uL6 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5NQ50 3.74e-51 165 45 0 177 3 rplF Large ribosomal subunit protein uL6 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B8ZKP5 3.99e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q9PE61 4.72e-51 164 47 1 176 3 rplF Large ribosomal subunit protein uL6 Xylella fastidiosa (strain 9a5c)
C1CPA3 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIB2 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain P1031)
C1CC21 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain JJA)
Q8CWV3 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS55 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain CGSP14)
B1I8L3 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain Hungary19A-6)
Q04MM1 5.84e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q38US6 6.24e-51 164 49 3 176 3 rplF Large ribosomal subunit protein uL6 Latilactobacillus sakei subsp. sakei (strain 23K)
Q5LW43 7.27e-51 164 45 0 177 3 rplF Large ribosomal subunit protein uL6 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
C1CAM7 8.1e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae (strain 70585)
A9WSU3 8.1e-51 164 44 0 175 3 rplF Large ribosomal subunit protein uL6 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q1WSA5 8.55e-51 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Ligilactobacillus salivarius (strain UCC118)
B0U5L4 9.8e-51 164 47 1 176 3 rplF Large ribosomal subunit protein uL6 Xylella fastidiosa (strain M12)
B5E6H0 1.12e-50 164 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pneumoniae serotype 19F (strain G54)
A7H641 1.43e-50 163 47 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A3CK79 1.51e-50 163 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus sanguinis (strain SK36)
Q5HSA5 1.7e-50 163 47 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter jejuni (strain RM1221)
A1W1U5 1.7e-50 163 47 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P7T9 1.7e-50 163 47 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FP06 1.7e-50 163 47 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A5V5Y7 1.72e-50 163 45 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q6MSP0 1.79e-50 163 45 1 176 3 rplF Large ribosomal subunit protein uL6 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q0ANR5 1.82e-50 163 46 0 177 3 rplF Large ribosomal subunit protein uL6 Maricaulis maris (strain MCS10)
Q2W2K6 2.41e-50 162 46 0 177 3 rplF Large ribosomal subunit protein uL6 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A0PXW1 2.59e-50 162 46 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium novyi (strain NT)
A1WKA1 2.72e-50 162 57 0 166 3 rplF Large ribosomal subunit protein uL6 Verminephrobacter eiseniae (strain EF01-2)
A8AZL0 2.87e-50 162 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B4SKX8 2.95e-50 162 47 2 176 3 rplF Large ribosomal subunit protein uL6 Stenotrophomonas maltophilia (strain R551-3)
Q03IG6 3.06e-50 162 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2C8 3.06e-50 162 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXS6 3.06e-50 162 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus thermophilus (strain CNRZ 1066)
Q87E67 3.25e-50 162 47 1 176 3 rplF Large ribosomal subunit protein uL6 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8I4 3.25e-50 162 47 1 176 3 rplF Large ribosomal subunit protein uL6 Xylella fastidiosa (strain M23)
Q890Q0 3.75e-50 162 44 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium tetani (strain Massachusetts / E88)
A4VSG8 4.25e-50 162 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus suis (strain 05ZYH33)
A4VYQ7 4.25e-50 162 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus suis (strain 98HAH33)
A6LLM8 4.33e-50 162 42 1 183 3 rplF Large ribosomal subunit protein uL6 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q39XZ1 4.52e-50 162 44 0 175 3 rplF Large ribosomal subunit protein uL6 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3PWT6 6.37e-50 161 44 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium etli (strain CIAT 652)
A0JZ70 6.43e-50 162 44 0 175 3 rplF Large ribosomal subunit protein uL6 Arthrobacter sp. (strain FB24)
Q8UE33 6.65e-50 161 43 0 177 3 rplF Large ribosomal subunit protein uL6 Agrobacterium fabrum (strain C58 / ATCC 33970)
C0ME20 7.65e-50 161 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U515 7.65e-50 161 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MAG5 7.65e-50 161 47 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus equi subsp. equi (strain 4047)
Q5FTZ8 7.65e-50 161 47 1 178 3 rplF Large ribosomal subunit protein uL6 Gluconobacter oxydans (strain 621H)
Q92QF5 9.13e-50 161 44 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium meliloti (strain 1021)
Q03PX2 1.05e-49 161 47 0 175 3 rplF Large ribosomal subunit protein uL6 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A6U874 1.44e-49 160 44 0 177 3 rplF Large ribosomal subunit protein uL6 Sinorhizobium medicae (strain WSM419)
Q0AUJ5 1.75e-49 160 47 0 175 3 rplF Large ribosomal subunit protein uL6 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B5ZYV0 1.94e-49 160 43 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2N9C6 2.09e-49 160 43 0 177 3 rplF Large ribosomal subunit protein uL6 Erythrobacter litoralis (strain HTCC2594)
Q250L7 2.13e-49 160 47 0 170 3 rplF Large ribosomal subunit protein uL6 Desulfitobacterium hafniense (strain Y51)
B8G1Y1 2.13e-49 160 47 0 170 3 rplF Large ribosomal subunit protein uL6 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B1XJJ3 2.58e-49 160 46 1 176 3 rplF Large ribosomal subunit protein uL6 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8DS28 2.59e-49 160 48 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A8LC41 3.22e-49 160 45 0 175 3 rplF Large ribosomal subunit protein uL6 Parafrankia sp. (strain EAN1pec)
P04448 3.25e-49 160 44 1 176 3 rplF Large ribosomal subunit protein uL6 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
B4U759 3.53e-49 160 44 1 175 3 rplF Large ribosomal subunit protein uL6 Hydrogenobaculum sp. (strain Y04AAS1)
B0C1E7 3.63e-49 160 48 0 175 3 rplF Large ribosomal subunit protein uL6 Acaryochloris marina (strain MBIC 11017)
B9JDU3 3.72e-49 159 44 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q04C00 3.77e-49 159 48 2 175 3 rplF Large ribosomal subunit protein uL6 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBK3 3.77e-49 159 48 2 175 3 rplF Large ribosomal subunit protein uL6 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A5D5G9 4.48e-49 159 46 0 170 3 rplF Large ribosomal subunit protein uL6 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C3MAZ5 4.58e-49 159 45 0 177 3 rplF Large ribosomal subunit protein uL6 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B3E845 5.14e-49 159 46 0 175 3 rplF Large ribosomal subunit protein uL6 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A8MLF5 5.49e-49 159 46 1 176 3 rplF Large ribosomal subunit protein uL6 Alkaliphilus oremlandii (strain OhILAs)
Q1MIC6 5.76e-49 159 43 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B6IRS1 5.82e-49 159 44 0 177 3 rplF Large ribosomal subunit protein uL6 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q8RIH1 6.08e-49 159 46 0 176 3 rplF Large ribosomal subunit protein uL6 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B2UQM5 7.05e-49 159 44 0 175 3 rplF Large ribosomal subunit protein uL6 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A7HM37 1.05e-48 159 43 1 183 3 rplF Large ribosomal subunit protein uL6 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A7IPQ5 1.23e-48 158 45 0 177 3 rplF Large ribosomal subunit protein uL6 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B9JVQ2 1.44e-48 158 42 0 177 3 rplF Large ribosomal subunit protein uL6 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B8HCZ2 1.52e-48 158 43 0 175 3 rplF Large ribosomal subunit protein uL6 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q0SQF9 1.56e-48 158 45 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium perfringens (strain SM101 / Type A)
Q8XHT8 1.56e-48 158 45 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium perfringens (strain 13 / Type A)
Q0TMR1 1.56e-48 158 45 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A9NEE8 1.9e-48 158 45 1 176 3 rplF Large ribosomal subunit protein uL6 Acholeplasma laidlawii (strain PG-8A)
Q9Z9J9 2.03e-48 158 46 0 175 3 rplF Large ribosomal subunit protein uL6 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9DSW5 2.08e-48 158 45 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03ZN1 2.12e-48 157 48 0 175 3 rplF Large ribosomal subunit protein uL6 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B9DM32 2.34e-48 157 47 2 176 3 rplF Large ribosomal subunit protein uL6 Staphylococcus carnosus (strain TM300)
B2TIJ0 2.38e-48 157 43 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Eklund 17B / Type B)
B0TC71 2.45e-48 158 49 2 172 3 rplF Large ribosomal subunit protein uL6 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q04G71 2.7e-48 157 45 0 175 3 rplF Large ribosomal subunit protein uL6 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q2K9K1 2.8e-48 157 42 0 177 3 rplF Large ribosomal subunit protein uL6 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C6C1A0 2.82e-48 157 45 0 175 3 rplF Large ribosomal subunit protein uL6 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B2UYC5 3.23e-48 157 43 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium botulinum (strain Alaska E43 / Type E3)
B1LBM5 3.98e-48 157 43 2 183 3 rplF Large ribosomal subunit protein uL6 Thermotoga sp. (strain RQ2)
A5IM98 3.98e-48 157 43 2 183 3 rplF Large ribosomal subunit protein uL6 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9KEF5 4e-48 157 44 1 169 3 rplF Large ribosomal subunit protein uL6 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A5GVX4 4.03e-48 157 46 0 175 3 rplF Large ribosomal subunit protein uL6 Synechococcus sp. (strain RCC307)
B8DW28 5.29e-48 157 44 0 174 3 rplF Large ribosomal subunit protein uL6 Bifidobacterium animalis subsp. lactis (strain AD011)
Q74L75 9.19e-48 156 47 2 175 3 rplF Large ribosomal subunit protein uL6 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q0BYC9 9.34e-48 157 42 1 203 3 rplF Large ribosomal subunit protein uL6 Hyphomonas neptunium (strain ATCC 15444)
B1MW00 9.76e-48 156 47 0 175 3 rplF Large ribosomal subunit protein uL6 Leuconostoc citreum (strain KM20)
A5FZV0 1.2e-47 155 44 0 177 3 rplF Large ribosomal subunit protein uL6 Acidiphilium cryptum (strain JF-5)
A1VEA1 1.44e-47 155 44 1 175 3 rplF Large ribosomal subunit protein uL6 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CG5 1.44e-47 155 44 1 175 3 rplF Large ribosomal subunit protein uL6 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1ALV6 1.68e-47 155 45 0 175 3 rplF Large ribosomal subunit protein uL6 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B8E1E8 1.85e-47 155 45 1 176 3 rplF Large ribosomal subunit protein uL6 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A6Q1J3 1.88e-47 155 47 4 172 3 rplF Large ribosomal subunit protein uL6 Nitratiruptor sp. (strain SB155-2)
Q7VGC9 1.94e-47 155 45 1 175 3 rplF Large ribosomal subunit protein uL6 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9ZAE4 1.97e-47 155 42 2 183 3 rplF Large ribosomal subunit protein uL6 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A7HZM1 2.23e-47 155 44 1 167 3 rplF Large ribosomal subunit protein uL6 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B3QYD9 2.74e-47 155 43 0 175 3 rplF Large ribosomal subunit protein uL6 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B4S5B3 3.33e-47 155 43 0 175 3 rplF Large ribosomal subunit protein uL6 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B5YDV8 3.88e-47 154 46 1 176 3 rplF Large ribosomal subunit protein uL6 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q318J8 3.88e-47 154 45 0 175 3 rplF Large ribosomal subunit protein uL6 Prochlorococcus marinus (strain MIT 9312)
B5XJ51 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE59 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT4 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC29 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z8 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ47 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP02 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE44 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNP4 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC0 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE58 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1V9 3.94e-47 154 46 0 175 3 rplF Large ribosomal subunit protein uL6 Streptococcus pyogenes serotype M1
B9L6L8 4.49e-47 154 44 1 167 3 rplF Large ribosomal subunit protein uL6 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A6LPS6 4.51e-47 154 43 1 176 3 rplF Large ribosomal subunit protein uL6 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2BYS2 5.75e-47 154 45 0 167 3 rplF Large ribosomal subunit protein uL6 Prochlorococcus marinus (strain MIT 9515)
B8D0D9 6.34e-47 154 48 3 179 3 rplF Large ribosomal subunit protein uL6 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A1SNK3 6.62e-47 154 44 1 176 3 rplF Large ribosomal subunit protein uL6 Nocardioides sp. (strain ATCC BAA-499 / JS614)
B7KI01 6.7e-47 154 45 0 175 3 rplF Large ribosomal subunit protein uL6 Gloeothece citriformis (strain PCC 7424)
A6GZ84 6.96e-47 154 43 1 179 3 rplF Large ribosomal subunit protein uL6 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q0ID19 7.07e-47 154 44 0 175 3 rplF Large ribosomal subunit protein uL6 Synechococcus sp. (strain CC9311)
Q3API8 7.39e-47 154 40 0 175 3 rplF Large ribosomal subunit protein uL6 Chlorobium chlorochromatii (strain CaD3)
Q8A491 8.57e-47 154 42 2 184 3 rplF Large ribosomal subunit protein uL6 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B2A4F4 1.14e-46 153 43 0 167 3 rplF Large ribosomal subunit protein uL6 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B9K8A1 1.42e-46 153 41 2 183 3 rplF Large ribosomal subunit protein uL6 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q046B1 1.48e-46 153 47 2 175 3 rplF Large ribosomal subunit protein uL6 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q98PZ7 1.64e-46 153 44 0 176 3 rplF Large ribosomal subunit protein uL6 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q7V531 1.88e-46 153 45 0 175 3 rplF Large ribosomal subunit protein uL6 Prochlorococcus marinus (strain MIT 9313)
Q6NJ87 1.91e-46 153 45 0 175 3 rplF Large ribosomal subunit protein uL6 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A0RM26 1.91e-46 153 43 1 175 3 rplF Large ribosomal subunit protein uL6 Campylobacter fetus subsp. fetus (strain 82-40)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18785
Feature type CDS
Gene rplF
Product 50S ribosomal protein L6
Location 15747 - 16280 (strand: -1)
Length 534 (nucleotides) / 177 (amino acids)
In genomic island -

Contig

Accession ZDB_385
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2417
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00347 Ribosomal protein L6

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0097 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L6P/L9E

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02933 large subunit ribosomal protein L6 Ribosome -

Protein Sequence

MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSRNIHNAVEVKHADNQLTFGPRDGYTDAWAQAGTTRALVNAMVVGVTEGFSKKLQLVGVGYRAAVKGDVVNLSVGFSHPVEHKLPAGVTAECPTQTEIVLKGADKQVIGQIAADLRAYRRPEPYKGKGIRYADEVVRIKEAKKK

Flanking regions ( +/- flanking 50bp)

GGTCTTGGTGGCGAGATTCTCTGCTACGTAGCATAATTCGGGAGGAAAGAATGTCTCGTGTGGCAAAAGCACCCGTCGTCATTCCTGCCGGCGTAGAGGTAAAACTCAACGGTCAGGTTATTTCGATTAAGGGTAAAAACGGCGAGCTGAGCCGTAATATCCACAACGCTGTAGAAGTTAAACATGCAGACAACCAGTTAACCTTTGGTCCGCGTGACGGTTATACCGACGCATGGGCACAGGCTGGTACAACTCGTGCACTGGTTAACGCTATGGTTGTTGGTGTTACCGAAGGCTTCTCTAAGAAGCTGCAACTGGTAGGTGTTGGTTATCGTGCAGCCGTTAAAGGTGATGTGGTAAACCTGTCTGTAGGTTTCTCTCACCCGGTAGAGCACAAACTGCCGGCTGGCGTTACTGCTGAATGTCCGACCCAAACTGAAATCGTACTGAAAGGTGCTGATAAGCAGGTTATTGGTCAGATCGCAGCAGACTTACGCGCCTATCGTCGCCCTGAACCTTACAAAGGTAAAGGTATTCGCTACGCCGACGAAGTCGTGCGTATTAAAGAGGCTAAGAAGAAGTAAGGTAACACTATGGATAAGAAAGCAGCTCGTATCCGTCGTGCGACCCGCGC