Homologs in group_1626

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10715 FBDBKF_10715 100.0 Morganella morganii S1 - putative [Fe-S]-dependent transcriptional repressor
EHELCC_15050 EHELCC_15050 100.0 Morganella morganii S2 - putative [Fe-S]-dependent transcriptional repressor
NLDBIP_14880 NLDBIP_14880 100.0 Morganella morganii S4 - putative [Fe-S]-dependent transcriptional repressor
HKOGLL_13085 HKOGLL_13085 100.0 Morganella morganii S5 - putative [Fe-S]-dependent transcriptional repressor
F4V73_RS14430 F4V73_RS14430 94.8 Morganella psychrotolerans - FeoC-like transcriptional regulator
PMI_RS14445 PMI_RS14445 63.6 Proteus mirabilis HI4320 - FeoC-like transcriptional regulator

Distribution of the homologs in the orthogroup group_1626

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1626

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZM4 3.55e-32 109 63 0 77 3 feoC Probable [Fe-S]-dependent transcriptional repressor Proteus mirabilis (strain HI4320)
Q7N9V4 6.15e-31 106 64 0 75 3 feoC Probable [Fe-S]-dependent transcriptional repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JSG1 7.55e-23 85 56 2 80 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JHZ7 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664K0 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGS1 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pestis (strain Pestoides F)
Q1CCL9 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFX5 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pestis
B2K5V5 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2M2 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNV6 7.65e-22 83 57 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GKT3 9.31e-20 78 53 2 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Serratia proteamaculans (strain 568)
A7MGD4 3.68e-19 76 47 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Cronobacter sakazakii (strain ATCC BAA-894)
A4WFJ8 3.76e-16 68 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Enterobacter sp. (strain 638)
B5XTS6 1.6e-15 67 41 2 79 1 feoC Probable [Fe-S]-dependent transcriptional repressor Klebsiella pneumoniae (strain 342)
A6TF33 2.22e-15 67 41 2 79 1 feoC Probable [Fe-S]-dependent transcriptional repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MMB8 3.39e-15 66 42 1 75 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C0Q0I2 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella paratyphi C (strain RKS4594)
B4SVL0 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella newport (strain SL254)
B5R7K7 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R367 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella enteritidis PT4 (strain P125109)
B5FJS8 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella dublin (strain CT_02021853)
Q57IW7 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella choleraesuis (strain SC-B67)
B5F8M3 4.5e-15 66 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella agona (strain SL483)
Q3YWL5 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella sonnei (strain Ss046)
Q83J94 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella flexneri
Q0SZQ8 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella flexneri serotype 5b (strain 8401)
B6I2X3 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain SE11)
B1IP55 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5L8 5.86e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O9:H4 (strain HS)
Q7CPK5 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG51 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella typhi
B4TY66 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella schwarzengrund (strain CVM19633)
B5BHG5 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella paratyphi A (strain AKU_12601)
A9MTS5 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLZ0 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TKT3 6.32e-15 65 41 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Salmonella heidelberg (strain SL476)
Q32AM4 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31VM2 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella boydii serotype 4 (strain Sb227)
B2U3M0 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LSB3 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LHL0 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain SMS-3-5 / SECEC)
P64638 9.27e-15 65 39 1 78 1 feoC Probable [Fe-S]-dependent transcriptional repressor FeoC Escherichia coli (strain K12)
B1X757 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain K12 / DH10B)
C4ZUR5 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1W6 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O8 (strain IAI1)
B5YTW1 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P64639 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O157:H7
B7L4U0 9.27e-15 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain 55989 / EAEC)
B7NE15 1.36e-14 65 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R5M4 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli (strain UTI89 / UPEC)
Q8FCT6 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TC57 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0C602 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O1:K1 / APEC
B7N143 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O81 (strain ED1a)
B7MDN6 2.1e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZST9 2.15e-14 64 39 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NMH5 2.68e-14 64 38 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UKB5 1.22e-13 62 38 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8AQW4 1.39e-13 62 38 1 78 3 feoC Probable [Fe-S]-dependent transcriptional repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8GHK8 5.19e-13 60 46 2 69 3 feoC Probable [Fe-S]-dependent transcriptional repressor Serratia marcescens

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14465
Feature type CDS
Gene -
Product putative [Fe-S]-dependent transcriptional repressor
Location 31668 - 31901 (strand: 1)
Length 234 (nucleotides) / 77 (amino acids)

Contig

Accession ZDB_372
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1626
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09012 FeoC like transcriptional regulator

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07490 ferrous iron transport protein C - -

Protein Sequence

MISLIAVRDAIALNGRADARLLSHQLNAPEALVQAIMEKLAAMGKIEAVDVSSCLSSSCKQCPESQGCDTKVYQIHS

Flanking regions ( +/- flanking 50bp)

GCTGTGGCGGCTGCTCCGGCAACGAGTGTCACTGATAAAAGGACACGGACATGATCAGCCTGATCGCAGTACGTGACGCCATTGCACTGAACGGCCGGGCAGATGCCCGGCTGCTCAGCCACCAGTTGAATGCCCCGGAAGCCCTGGTGCAGGCCATCATGGAAAAGCTGGCTGCCATGGGAAAAATTGAAGCGGTGGATGTCAGCAGCTGTCTGAGCAGCAGCTGCAAACAGTGCCCTGAAAGTCAGGGCTGTGACACAAAGGTGTATCAGATTCATTCATAAAACTTACCCGCCGTTGTGCGGGTATTCTTTTATTTAACAAACTCCGTCAG