Homologs in group_2917

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13760 FBDBKF_13760 100.0 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_11430 EHELCC_11430 100.0 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_11775 NLDBIP_11775 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_10245 HKOGLL_10245 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS12630 F4V73_RS12630 97.4 Morganella psychrotolerans - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2917

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2917

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43011 1.32e-48 166 33 2 280 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52689 1.23e-47 164 32 6 301 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
P30864 1.65e-44 156 32 5 293 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
P72131 7.09e-44 155 34 2 292 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37641 4.7e-41 147 31 1 280 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
Q9JPU9 5.17e-41 147 31 3 289 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
Q9JXW7 5.98e-40 144 30 3 289 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q01610 2.98e-39 142 32 3 290 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P76250 3.12e-39 142 29 2 298 1 dmlR HTH-type transcriptional regulator DmlR Escherichia coli (strain K12)
P45463 3.71e-38 140 30 2 300 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
Q1R6S1 5.78e-38 139 30 2 300 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 5.78e-38 139 30 2 300 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XBK9 6.77e-38 139 30 2 300 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
Q0TD46 7.44e-38 139 30 2 300 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A0A0H2ZDG9 4.85e-36 134 30 2 283 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P67662 9.82e-36 134 29 2 294 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 9.82e-36 134 29 2 294 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 9.82e-36 134 29 2 294 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
P75836 1.33e-34 130 25 2 289 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
P77333 5.42e-33 126 28 3 293 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
P45099 4.01e-19 89 28 7 282 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0ACR4 7.88e-19 87 23 6 302 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 7.88e-19 87 23 6 302 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 7.88e-19 87 23 6 302 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
P37459 3.61e-18 86 24 4 295 3 sinR Probable HTH-type transcriptional regulator SinR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9F6 1.3e-14 76 25 3 240 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 1.3e-14 76 25 3 240 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 1.3e-14 76 25 3 240 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
A5F9F9 3.18e-14 75 23 4 282 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0C6D1 3.71e-14 74 23 4 282 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P55576 4.21e-14 74 25 7 272 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P14145 7.99e-14 73 25 5 259 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
P52686 2.26e-13 72 26 5 266 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
P37682 2.55e-13 72 22 5 294 3 yiaU Uncharacterized HTH-type transcriptional regulator YiaU Escherichia coli (strain K12)
Q8KA72 4.19e-13 72 24 7 261 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P46068 5.13e-13 71 27 7 246 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P77744 2.64e-12 69 24 4 174 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
O87883 3.66e-12 67 34 4 149 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
Q57748 5.03e-12 68 23 6 256 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P33634 5.05e-12 68 22 8 303 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P39647 6.42e-12 68 23 7 258 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
Q55459 1.04e-11 67 24 10 302 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P44821 1.06e-11 67 30 0 120 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44311 3.29e-11 66 22 7 248 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
P52660 3.57e-11 66 23 8 259 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
Q57083 4.57e-11 65 22 6 268 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P52696 5.51e-11 65 24 1 159 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
Q47005 1.12e-10 64 28 2 138 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
A4QH19 2.52e-10 63 31 3 142 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
Q5N5I5 2.74e-10 63 23 11 308 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 2.74e-10 63 23 11 308 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P42722 3.02e-10 63 24 6 250 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O35038 4.83e-10 63 28 2 137 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
O34827 4.98e-10 62 27 0 121 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
P42507 7.75e-10 62 23 7 289 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A7Z5E4 1.12e-09 61 24 6 249 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P94387 1.2e-09 62 25 3 166 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
O06703 1.57e-09 61 25 3 193 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3MCB5 2.71e-09 60 25 5 256 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P52670 3.38e-09 60 31 0 116 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q81IX0 4.58e-09 60 25 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q85G62 5.21e-09 59 23 6 269 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
O33812 5.36e-09 59 21 6 246 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
P52678 5.6e-09 59 31 4 150 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P16931 5.79e-09 59 31 2 135 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
Q6HPH4 5.89e-09 59 25 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8YQ82 6.26e-09 59 25 7 259 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q63H01 6.46e-09 59 25 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 6.46e-09 59 25 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
P0ACR8 7.48e-09 59 31 2 123 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 7.48e-09 59 31 2 123 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
A2CI69 8.35e-09 59 23 6 262 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
A0T0G2 9.04e-09 59 21 7 246 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
A0R8S0 9.61e-09 58 25 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P73123 9.67e-09 59 24 6 262 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q08597 1.68e-08 58 37 0 85 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
P39592 1.74e-08 58 26 0 119 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
P77700 1.94e-08 58 32 0 93 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P52683 1.95e-08 58 25 4 241 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
Q6B936 2.06e-08 58 23 5 259 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
O69772 2.12e-08 57 26 8 246 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
Q3K7N4 2.32e-08 57 25 11 266 3 argP HTH-type transcriptional regulator ArgP Pseudomonas fluorescens (strain Pf0-1)
P27111 2.35e-08 57 26 1 153 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
Q4G384 2.63e-08 57 24 8 259 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
O78432 2.83e-08 57 24 8 266 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
Q81VJ1 3.44e-08 57 24 9 256 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
O87324 4.85e-08 57 31 4 149 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
Q8X4M5 5.97e-08 56 24 2 153 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
O34685 6.22e-08 56 24 8 250 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
P44418 1.47e-07 55 25 4 178 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24734 1.71e-07 55 24 6 246 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P94501 1.73e-07 55 22 7 249 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
P48271 1.82e-07 55 23 8 255 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
P56885 2.7e-07 54 23 9 259 3 cbbR HTH-type transcriptional regulator CbbR Sinorhizobium medicae (strain WSM419)
Q9X5P2 2.97e-07 54 31 2 121 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
A0T0V5 3.02e-07 54 21 5 256 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
Q9I6Z9 3.22e-07 54 22 8 273 3 bauR HTH-type transcriptional activator BauR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52677 4.59e-07 53 29 4 149 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
P52659 8.19e-07 53 24 8 272 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
P52669 9.78e-07 53 23 4 154 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P70785 1.01e-06 53 24 1 131 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
Q06610 1.03e-06 53 21 9 313 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P71318 1.08e-06 52 23 3 161 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
P58332 1.19e-06 52 23 9 256 3 cbbR HTH-type transcriptional regulator CbbR Rhizobium meliloti (strain 1021)
Q9X725 1.19e-06 52 23 3 161 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P77309 1.27e-06 52 22 8 265 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
P77559 1.72e-06 52 25 6 182 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
P52685 1.76e-06 52 26 1 142 3 mauR Mau operon transcriptional activator Paracoccus denitrificans
P52595 4.3e-06 51 24 9 252 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
O32255 4.85e-06 50 23 1 123 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
P0ACQ4 5.71e-06 50 21 1 160 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 5.71e-06 50 21 1 160 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 5.71e-06 50 21 1 160 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
P37499 5.88e-06 50 23 9 234 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
Q1RF30 6.16e-06 50 39 0 69 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 6.16e-06 50 39 0 69 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
P45461 6.5e-06 50 31 3 147 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P07774 6.86e-06 50 28 5 153 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O19892 7.69e-06 50 21 5 258 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P52666 9.54e-06 50 25 3 141 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
P67660 1.02e-05 50 27 8 254 1 yhaJ Probable HTH-type transcriptional regulator YhaJ Escherichia coli (strain K12)
P67661 1.02e-05 50 27 8 254 1 yhaJ HTH-type transcriptional regulator YhaJ Escherichia coli O157:H7
Q04778 1.05e-05 50 25 0 116 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
Q9S4Y7 1.07e-05 50 40 0 69 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 1.07e-05 50 40 0 69 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57S50 1.2e-05 49 40 0 69 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
P0ACR0 1.31e-05 49 31 2 114 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 1.31e-05 49 31 2 114 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
P39376 2.08e-05 48 30 0 79 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
O07906 2.12e-05 48 23 0 118 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P33651 2.14e-05 48 28 7 200 3 blaA HTH-type transcriptional regulator BlaA Streptomyces cacaoi
Q8Z8R3 2.66e-05 48 40 0 69 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P20668 2.68e-05 48 26 0 103 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
O68014 3.44e-05 48 24 10 249 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P71025 3.81e-05 48 22 7 248 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
Q8FK66 4e-05 48 37 0 69 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 4e-05 48 37 0 69 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1XDT2 5.44e-05 47 22 5 259 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P51205 5.8e-05 47 22 5 259 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q765S2 9.33e-05 47 24 5 183 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
P55181 9.48e-05 47 23 0 121 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
P49518 0.000144 46 23 11 256 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P45105 0.000162 46 24 10 237 3 cysB HTH-type transcriptional regulator CysB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96194 0.000181 44 30 1 91 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
P42427 0.000285 45 24 4 146 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P52665 0.000563 43 28 0 82 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P75684 0.000685 42 23 1 114 3 yagP Putative LysR family substrate binding domain-containing protein YagP Escherichia coli (strain K12)
P05827 0.000716 44 22 1 167 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
P52690 0.000814 44 25 13 292 3 cbbR HTH-type transcriptional regulator CbbR Cereibacter sphaeroides

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11635
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 128931 - 129854 (strand: 1)
Length 924 (nucleotides) / 307 (amino acids)

Contig

Accession ZDB_368
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2917
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MLPAHEYANDLILFALIVDCGSFSKAAEMAGVTGSVLSKRVGRLEKALGARLLYRTTRSLSVTENGRVLYQHAKSLTGQVHSALQAVSANSDELTGLIRMSVPTISGELVLSDSVAEFCEKYPNVKVEMHLENRFVDLVNERIDLAIRTGMMSDSSLIARPLIDSHWVILASPRYLEKHPAPQNPEDLLTHNCLTYTYQQSGTSNWLMRRPDTGEIYELQVSGNIAFNNARAIRKALLSGHGIAMVPRCMVHEDLEAGLLTEVLPGYSGKKLGVYAVYPYTRHLPVKIRLLIDHIQASYQAISPYFG

Flanking regions ( +/- flanking 50bp)

TGATATAGTGAATGCTGTTTATTGTTTCATTCACTGCCGGAGGTTTTACCATGCTGCCCGCCCACGAGTACGCCAATGATCTGATTTTATTTGCGCTGATTGTGGATTGCGGCTCCTTCAGTAAAGCGGCGGAAATGGCCGGTGTCACCGGCTCTGTGCTCAGCAAACGGGTAGGACGGCTGGAAAAAGCCCTCGGCGCCCGTCTTCTCTACCGCACCACCCGCAGCCTCTCTGTCACGGAAAACGGCCGCGTGCTGTATCAGCATGCCAAATCCCTTACCGGCCAGGTTCACAGTGCCTTGCAGGCAGTCAGTGCCAACAGTGATGAACTGACCGGTCTTATACGTATGTCAGTACCCACTATCTCCGGAGAGCTGGTTCTCAGCGACAGCGTGGCGGAATTCTGTGAAAAATACCCCAATGTGAAAGTGGAAATGCATCTGGAGAACCGGTTTGTTGACCTGGTGAATGAACGGATTGATCTGGCTATCCGTACCGGGATGATGAGTGACTCCAGCCTGATAGCCCGTCCGCTGATTGATTCTCACTGGGTGATCCTCGCCTCCCCCCGCTATCTGGAAAAACACCCCGCGCCGCAGAATCCGGAAGATTTACTGACACACAACTGCCTCACCTACACCTATCAGCAAAGCGGTACCTCAAACTGGCTGATGCGCCGCCCGGATACCGGTGAAATCTATGAATTGCAGGTAAGCGGTAATATCGCTTTCAATAATGCCCGCGCCATCCGCAAAGCACTGCTCAGCGGCCACGGTATCGCCATGGTGCCGCGCTGTATGGTGCATGAGGATCTGGAGGCCGGGTTGCTGACGGAAGTTCTGCCGGGTTACAGCGGCAAAAAACTCGGCGTGTATGCCGTATATCCGTACACCCGCCATCTGCCGGTCAAAATCCGCCTGCTGATCGATCATATTCAGGCGTCATATCAGGCAATCAGTCCTTATTTCGGCTGACAGATTCAGGATTGTTATCTATCTGTGATATTGATTAGTCGATTTTTGGA