Homologs in group_3413

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13670 FBDBKF_13670 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_11340 EHELCC_11340 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_11685 NLDBIP_11685 100.0 Morganella morganii S4 - hypothetical protein
HKOGLL_10155 HKOGLL_10155 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3413

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3413

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11545
Feature type CDS
Gene -
Product hypothetical protein
Location 90476 - 90574 (strand: -1)
Length 99 (nucleotides) / 32 (amino acids)

Contig

Accession ZDB_368
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3413
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MEPTLSRKLALAALLPGQQPGTEYQPEWQLPR

Flanking regions ( +/- flanking 50bp)

CTGAGCTGACACCCCACCACAGCAGATAATTCAGCCCGGGTGAGGGGGCTATGGAACCTACCCTCTCACGCAAACTGGCACTGGCTGCGCTTCTGCCGGGCCAACAACCTGGTACAGAGTATCAGCCGGAGTGGCAACTGCCGCGATAATGCTTTGATCTAATCGTTTTACTGAAAAAAGAGTGCATCAGAAAGCGTAT