Homologs in group_3494

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16850 FBDBKF_16850 100.0 Morganella morganii S1 - Integrating conjugative element membrane protein
EHELCC_10610 EHELCC_10610 100.0 Morganella morganii S2 - Integrating conjugative element membrane protein
NLDBIP_10955 NLDBIP_10955 100.0 Morganella morganii S4 - Integrating conjugative element membrane protein
HKOGLL_16565 HKOGLL_16565 100.0 Morganella morganii S5 - Integrating conjugative element membrane protein

Distribution of the homologs in the orthogroup group_3494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_10400
Feature type CDS
Gene -
Product Integrating conjugative element membrane protein
Location 45792 - 46106 (strand: -1)
Length 315 (nucleotides) / 104 (amino acids)
In genomic island -

Contig

Accession ZDB_367
Length 191445 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3494
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF14348 Domain of unknown function (DUF4400)

Protein Sequence

MQIFLMRVAILILSAPLFIMAAITGFTDGMVRRDLRRYGAASESSFLYHHAKRAVKSALYFPCILYFSVLLTVYPNLFLLPAAPLSGLAYRLRRRVVRSICGID

Flanking regions ( +/- flanking 50bp)

TACAGATAACAGAGGCCGGATACCCGTATCTGATAGCAACCGTGCATGTTATGCAGATATTCCTGATGCGGGTGGCGATCCTGATATTGTCCGCGCCGTTATTTATCATGGCCGCCATCACCGGATTCACCGATGGCATGGTGCGTCGTGACCTGCGGCGGTACGGTGCCGCTAGTGAATCCAGTTTTCTCTATCACCACGCCAAACGTGCGGTGAAATCGGCGCTGTACTTCCCTTGTATCCTGTACTTCTCCGTACTGCTTACGGTATATCCGAATCTGTTTCTGCTACCCGCTGCACCGCTGAGCGGACTGGCATATCGCTTACGGCGAAGAGTTGTAAGAAGTATCTGTGGTATTGATTGATATTTCGAATAGTTAGGCGTATCCTTAGTGAAGGCTTTATTCGTATGCCA