Homologs in group_3490

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16830 FBDBKF_16830 100.0 Morganella morganii S1 - TIGR03758 family integrating conjugative element protein
EHELCC_10630 EHELCC_10630 100.0 Morganella morganii S2 - TIGR03758 family integrating conjugative element protein
NLDBIP_10975 NLDBIP_10975 100.0 Morganella morganii S4 - TIGR03758 family integrating conjugative element protein
HKOGLL_16545 HKOGLL_16545 100.0 Morganella morganii S5 - TIGR03758 family integrating conjugative element protein

Distribution of the homologs in the orthogroup group_3490

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3490

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_10380
Feature type CDS
Gene -
Product TIGR03758 family integrating conjugative element protein
Location 43302 - 43538 (strand: -1)
Length 237 (nucleotides) / 78 (amino acids)
In genomic island -

Contig

Accession ZDB_367
Length 191445 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3490
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF11660 Protein of unknown function (DUF3262)

Protein Sequence

MTGAQLAAFKLAALNTEPERLSALFTGVLIAVLFLWTARGLLLVYRGYAAGTVAEPVLLRFVVRSVLLLVISLFLCAG

Flanking regions ( +/- flanking 50bp)

TTATACAAGGAGATTGCTGTGTCTGTTACCCGATTCCGGGATTCATTCCTGTGACCGGTGCTCAGTTGGCGGCGTTTAAACTCGCGGCGCTCAATACGGAACCGGAGCGGCTCAGTGCGTTGTTCACCGGCGTGCTGATTGCCGTGCTGTTTCTCTGGACTGCGCGGGGTCTGCTGCTTGTGTATCGCGGTTATGCCGCCGGTACGGTGGCGGAGCCGGTGCTGTTGCGCTTCGTGGTCCGTTCGGTGCTGCTGCTGGTTATCTCTCTCTTTCTCTGTGCCGGATGATTCCGGCTTTTTTCGTTTGCATAAGGACATCACCATGTTTCATTCCCTGG