Homologs in group_1293

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07190 FBDBKF_07190 100.0 Morganella morganii S1 trm112 RNA methyltransferase activator Trm112/YbaR
EHELCC_03780 EHELCC_03780 100.0 Morganella morganii S2 trm112 RNA methyltransferase activator Trm112/YbaR
NLDBIP_03780 NLDBIP_03780 100.0 Morganella morganii S4 trm112 RNA methyltransferase activator Trm112/YbaR
HKOGLL_09365 HKOGLL_09365 100.0 Morganella morganii S5 trm112 RNA methyltransferase activator Trm112/YbaR
F4V73_RS01375 F4V73_RS01375 94.8 Morganella psychrotolerans - Trm112 family protein
PMI_RS03545 PMI_RS03545 77.6 Proteus mirabilis HI4320 - Trm112 family protein

Distribution of the homologs in the orthogroup group_1293

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1293

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N6C3 3.98e-27 95 80 0 57 3 plu1633 UPF0434 protein plu1633 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4ET33 4.22e-26 92 78 0 57 3 PMI0721 UPF0434 protein PMI0721 Proteus mirabilis (strain HI4320)
A1JMK8 6.97e-25 89 75 0 57 3 YE1549 UPF0434 protein YE1549 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1CA61 2.41e-24 88 75 0 57 3 YPA_0693 UPF0434 protein YPA_0693 Yersinia pestis bv. Antiqua (strain Antiqua)
B1JQT7 2.41e-24 88 75 0 57 3 YPK_2661 UPF0434 protein YPK_2661 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CGH4 2.41e-24 88 75 0 57 3 YPN_2578 UPF0434 protein YPN_2578 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FJV9 2.41e-24 88 75 0 57 3 YpsIP31758_2572 UPF0434 protein YpsIP31758_2572 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TN09 2.41e-24 88 75 0 57 3 YPDSF_2296 UPF0434 protein YPDSF_2296 Yersinia pestis (strain Pestoides F)
A9R7J2 2.41e-24 88 75 0 57 3 YpAngola_A1964 UPF0434 protein YpAngola_A1964 Yersinia pestis bv. Antiqua (strain Angola)
B2KA33 2.41e-24 88 75 0 57 3 YPTS_1526 UPF0434 protein YPTS_1526 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66CH9 2.41e-24 88 75 0 57 3 YPTB1424 UPF0434 protein YPTB1424 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74VT6 2.41e-24 88 75 0 57 3 YPO1399 UPF0434 protein YPO1399/y2773.1/YP_1194 Yersinia pestis
A7MV11 1.09e-23 86 72 0 58 3 VIBHAR_01537 UPF0434 protein VIBHAR_01537 Vibrio campbellii (strain ATCC BAA-1116)
Q6D439 1.49e-23 86 73 0 57 3 ECA2555 UPF0434 protein ECA2555 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DFA3 1.61e-23 86 75 0 57 3 PC1_1771 UPF0434 protein PC1_1771 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7MJ09 2.05e-23 85 70 0 58 3 VV2354 UPF0434 protein VV2354 Vibrio vulnificus (strain YJ016)
Q8DAV0 2.05e-23 85 70 0 58 3 VV1_2087 UPF0434 protein VV1_2087 Vibrio vulnificus (strain CMCP6)
A5F727 8.91e-23 84 70 0 58 3 VC0395_A1467 UPF0434 protein VC0395_A1467/VC395_1991 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KQX1 8.91e-23 84 70 0 58 3 VC_1876 UPF0434 protein VC_1876 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LNI0 8.91e-23 84 70 0 58 3 VCM66_1800 UPF0434 protein VCM66_1800 Vibrio cholerae serotype O1 (strain M66-2)
A7MET6 1.16e-22 84 68 0 57 3 ESA_02427 UPF0434 protein ESA_02427 Cronobacter sakazakii (strain ATCC BAA-894)
Q3IGX7 1.18e-22 84 68 0 57 3 PSHAa1659 UPF0434 protein PSHAa1659 Pseudoalteromonas translucida (strain TAC 125)
A8GCI2 1.93e-22 83 71 0 57 3 Spro_1718 UPF0434 protein Spro_1718 Serratia proteamaculans (strain 568)
C5BAD8 2.49e-22 83 65 0 58 3 NT01EI_2448 UPF0434 protein NT01EI_2448 Edwardsiella ictaluri (strain 93-146)
Q6LPK8 3.75e-22 82 71 0 57 3 PBPRA2383 UPF0434 protein PBPRA2383 Photobacterium profundum (strain SS9)
B7VH36 4.28e-22 82 67 0 58 3 VS_2060 UPF0434 protein VS_2060 Vibrio atlanticus (strain LGP32)
B2VC72 5.35e-22 82 72 0 58 3 ETA_21370 UPF0434 protein ETA_21370 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4TRU9 9.27e-22 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella schwarzengrund (strain CVM19633)
A9MHW6 9.27e-22 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CQT7 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEM5 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella typhi
B5BBP1 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella paratyphi A (strain AKU_12601)
C0PXV4 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella paratyphi C (strain RKS4594)
A9N7U5 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGF4 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T151 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella newport (strain SL254)
B4TDQ4 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella heidelberg (strain SL476)
B5R8K4 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZC1 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella enteritidis PT4 (strain P125109)
B5FQ60 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella dublin (strain CT_02021853)
Q57R11 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella choleraesuis (strain SC-B67)
B5F170 1.08e-21 81 67 0 58 3 ycaR UPF0434 protein YcaR Salmonella agona (strain SL483)
Q5E0F0 2.53e-21 80 68 0 57 3 VF_A0426 UPF0434 protein VF_A0426 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5ETK6 2.53e-21 80 68 0 57 3 VFMJ11_A0475 UPF0434 protein VFMJ11_A0475 Aliivibrio fischeri (strain MJ11)
B7LN79 5.55e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XY80 6.91e-21 79 67 0 58 3 KPK_3615 UPF0434 protein KPK_3615 Klebsiella pneumoniae (strain 342)
A8AIG4 7.3e-21 79 63 0 58 3 CKO_02153 UPF0434 protein CKO_02153 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z3K4 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella sonnei (strain Ss046)
P0AB00 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella flexneri
Q0SWZ8 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella flexneri serotype 5b (strain 8401)
Q32E37 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT3 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella boydii serotype 4 (strain Sb227)
B2TUG2 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU1 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain UTI89 / UPEC)
B1LJU6 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y9 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain SE11)
B7NAR6 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAZ7 9.82e-21 79 65 0 58 1 ycaR UPF0434 protein YcaR Escherichia coli (strain K12)
B1IW14 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAZ8 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJD6 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL9 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O9:H4 (strain HS)
B1X8M1 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain K12 / DH10B)
C4ZQ43 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M846 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O8 (strain IAI1)
B7NM57 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT51 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AAZ9 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O157:H7
B7LE15 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli (strain 55989 / EAEC)
B7MHM6 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN03 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZK06 9.82e-21 79 65 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O139:H28 (strain E24377A / ETEC)
C4L8W1 9.99e-21 79 64 0 57 3 Tola_2233 UPF0434 protein Tola_2233 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3J7R6 1.12e-20 79 66 0 53 3 Noc_2677 UPF0434 protein Noc_2677 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C4K359 1.64e-20 78 63 0 57 3 HDEF_0234 UPF0434 protein HDEF_0234 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7MS35 2.16e-20 78 63 0 58 3 ycaR UPF0434 protein YcaR Escherichia coli O81 (strain ED1a)
Q1GZI2 2.31e-20 78 63 0 57 3 Mfla_2088 UPF0434 protein Mfla_2088 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4W8T6 2.82e-20 78 65 0 58 3 Ent638_1436 UPF0434 protein Ent638_1436 Enterobacter sp. (strain 638)
C1D6I8 3.03e-20 77 63 0 57 3 LHK_01103 UPF0434 protein LHK_01103 Laribacter hongkongensis (strain HLHK9)
A6T709 4.93e-20 77 65 0 58 3 KPN78578_09190 UPF0434 protein KPN78578_09190 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2NUA3 4.99e-20 77 66 0 57 3 SG0997 UPF0434 protein SG0997 Sodalis glossinidius (strain morsitans)
Q5ZU87 3.92e-19 75 64 1 57 3 lpg1920 UPF0434 protein lpg1920 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X3Y6 3.92e-19 75 64 1 57 3 lpp1895 UPF0434 protein lpp1895 Legionella pneumophila (strain Paris)
A5ID78 3.92e-19 75 64 1 57 3 LPC_1374 UPF0434 protein LPC_1374 Legionella pneumophila (strain Corby)
Q483B4 9.49e-19 74 60 0 58 3 CPS_2127 UPF0434 protein CPS_2127 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q47B44 1.96e-18 73 58 0 53 3 Daro_3207 UPF0434 protein Daro_3207 Dechloromonas aromatica (strain RCB)
A0KYE0 2.08e-18 73 60 1 58 3 Shewana3_2582 UPF0434 protein Shewana3_2582 Shewanella sp. (strain ANA-3)
Q0HTT0 2.08e-18 73 60 1 58 3 Shewmr7_2490 UPF0434 protein Shewmr7_2490 Shewanella sp. (strain MR-7)
Q0HHH6 2.08e-18 73 60 1 58 3 Shewmr4_2420 UPF0434 protein Shewmr4_2420 Shewanella sp. (strain MR-4)
A1W893 2.27e-18 73 64 0 53 3 Ajs_2306 UPF0434 protein Ajs_2306 Acidovorax sp. (strain JS42)
B9MI82 2.27e-18 73 64 0 53 3 Dtpsy_1553 UPF0434 protein Dtpsy_1553 Acidovorax ebreus (strain TPSY)
Q8EDF2 2.45e-18 73 62 1 58 3 SO_2800 UPF0434 protein SO_2800 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1KNM8 2.91e-18 72 70 0 50 3 Swoo_1821 UPF0434 protein Swoo_1821 Shewanella woodyi (strain ATCC 51908 / MS32)
Q7NSS5 3.23e-18 72 57 0 57 1 CV_3345 UPF0434 protein CV_3345 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A3QDF9 3.93e-18 72 68 0 50 3 Shew_1640 UPF0434 protein Shew_1640 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5WVD1 4.38e-18 72 63 1 57 3 lpl1884 UPF0434 protein lpl1884 Legionella pneumophila (strain Lens)
Q2SIN3 5.47e-18 72 56 0 57 3 HCH_02705 UPF0434 protein HCH_02705 Hahella chejuensis (strain KCTC 2396)
A1VNK4 5.85e-18 72 59 0 57 3 Pnap_1922 UPF0434 protein Pnap_1922 Polaromonas naphthalenivorans (strain CJ2)
B8EF44 6.44e-18 72 58 1 58 3 Sbal223_2672 UPF0434 protein Sbal223_2672 Shewanella baltica (strain OS223)
A9KXE1 6.44e-18 72 58 1 58 3 Sbal195_1707 UPF0434 protein Sbal195_1707 Shewanella baltica (strain OS195)
A3D383 6.44e-18 72 58 1 58 3 Sbal_1685 UPF0434 protein Sbal_1685 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9IQ32 6.99e-18 72 58 0 53 3 Bpet2671 UPF0434 protein Bpet2671 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q080T4 7.41e-18 72 62 0 53 3 Sfri_2386 UPF0434 protein Sfri_2386 Shewanella frigidimarina (strain NCIMB 400)
A6WLX6 7.67e-18 72 58 1 58 3 Shew185_1670 UPF0434 protein Shew185_1670 Shewanella baltica (strain OS185)
A8H3F8 7.89e-18 71 62 0 53 3 Spea_1772 UPF0434 protein Spea_1772 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TK42 8.34e-18 71 64 0 53 3 Shal_2504 UPF0434 protein Shal_2504 Shewanella halifaxensis (strain HAW-EB4)
A6T171 9.07e-18 71 53 0 58 3 mma_2578 UPF0434 protein mma_2578 Janthinobacterium sp. (strain Marseille)
B8GR39 9.38e-18 71 59 0 57 3 Tgr7_1374 UPF0434 protein Tgr7_1374 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1RL19 1.01e-17 71 59 1 57 3 Sputw3181_2540 UPF0434 protein Sputw3181_2540 Shewanella sp. (strain W3-18-1)
A4Y5Q1 1.01e-17 71 59 1 57 3 Sputcn32_1559 UPF0434 protein Sputcn32_1559 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8CNQ6 1.03e-17 71 62 0 53 3 swp_2279 UPF0434 protein swp_2279 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0AEA0 1.58e-17 77 64 0 57 3 lpxK Tetraacyldisaccharide 4'-kinase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A8FX58 1.59e-17 71 58 0 58 3 Ssed_2824 UPF0434 protein Ssed_2824 Shewanella sediminis (strain HAW-EB3)
Q60B48 1.64e-17 71 57 0 57 3 MCA0634 UPF0434 protein MCA0634 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1LR06 1.74e-17 71 61 0 52 3 Rmet_0534 UPF0434 protein Rmet_0534 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2JDV3 1.81e-17 71 61 0 52 3 Bphy_0537 UPF0434 protein Bphy_0537 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q13US0 1.81e-17 71 61 0 52 3 Bxeno_A3631 UPF0434 protein Bxeno_A3631 Paraburkholderia xenovorans (strain LB400)
B2T6M2 1.81e-17 71 61 0 52 3 Bphyt_3197 UPF0434 protein Bphyt_3197 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q48L53 1.9e-17 70 59 0 57 3 PSPPH_1629 UPF0434 protein PSPPH_1629 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q475F9 1.91e-17 71 61 0 52 3 Reut_A0592 UPF0434 protein Reut_A0592 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1S590 1.96e-17 70 68 0 50 3 Sama_1339 UPF0434 protein Sama_1339 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0KE18 2.09e-17 70 61 0 52 3 H16_A0605 UPF0434 protein H16_A0605 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R0X9 2.13e-17 70 61 0 52 3 RALTA_A0561 UPF0434 protein RALTA_A0561 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q3SIR6 2.19e-17 70 60 0 53 3 Tbd_1506 UPF0434 protein Tbd_1506 Thiobacillus denitrificans (strain ATCC 25259)
Q3K8J3 2.64e-17 70 57 0 57 3 Pfl01_4174 UPF0434 protein Pfl01_4174 Pseudomonas fluorescens (strain Pf0-1)
Q87YF6 2.64e-17 70 57 0 57 3 PSPTO_3844 UPF0434 protein PSPTO_3844 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q82SY2 2.82e-17 76 63 0 57 3 lpxK Tetraacyldisaccharide 4'-kinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1TQ98 3.14e-17 70 57 0 57 3 Aave_2563 UPF0434 protein Aave_2563 Paracidovorax citrulli (strain AAC00-1)
Q129C8 4.17e-17 70 60 0 53 3 Bpro_2950 UPF0434 protein Bpro_2950 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2YA91 4.37e-17 70 57 0 57 3 Nmul_A1027 UPF0434 protein Nmul_A1027 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C3JY28 4.47e-17 70 56 0 57 3 PFLU_3771 UPF0434 protein PFLU_3771 Pseudomonas fluorescens (strain SBW25)
Q4KFT4 4.77e-17 70 56 0 57 1 PFL_1779 UPF0434 protein PFL_1779 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B4E9F9 1.01e-16 69 59 0 52 3 BceJ2315_26980 UPF0434 protein BceJ2315_26980 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1JXF6 1.01e-16 69 59 0 52 3 Bcenmc03_2570 UPF0434 protein Bcenmc03_2570 Burkholderia orbicola (strain MC0-3)
A0K9W9 1.01e-16 69 59 0 52 3 Bcen2424_2546 UPF0434 protein Bcen2424_2546 Burkholderia cenocepacia (strain HI2424)
Q1BU68 1.01e-16 69 59 0 52 3 Bcen_1934 UPF0434 protein Bcen_1934 Burkholderia orbicola (strain AU 1054)
B0U169 1.04e-16 68 52 0 57 3 Fphi_1862 UPF0434 protein Fphi_1862 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B1XTC7 1.09e-16 68 56 0 57 3 Pnec_0311 UPF0434 protein Pnec_0311 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A9AGK3 1.54e-16 68 61 0 52 3 Bmul_0750 UPF0434 protein Bmul_0750/BMULJ_02510 Burkholderia multivorans (strain ATCC 17616 / 249)
Q21TN8 1.57e-16 68 56 0 53 3 Rfer_3156 UPF0434 protein Rfer_3156 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4JH78 1.75e-16 68 59 0 52 3 Bcep1808_2639 UPF0434 protein Bcep1808_2639 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BCH3 1.75e-16 68 59 0 52 3 Bamb_2594 UPF0434 protein Bamb_2594 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YVD8 1.75e-16 68 59 0 52 3 BamMC406_2464 UPF0434 protein BamMC406_2464 Burkholderia ambifaria (strain MC40-6)
B2UB83 2.04e-16 68 59 0 52 3 Rpic_2808 UPF0434 protein Rpic_2808 Ralstonia pickettii (strain 12J)
Q39DJ5 2.34e-16 68 59 0 52 3 Bcep18194_A5877 UPF0434 protein Bcep18194_A5877 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4XSR3 2.37e-16 68 54 0 57 3 Pmen_1615 UPF0434 protein Pmen_1615 Pseudomonas mendocina (strain ymp)
A0L636 2.49e-16 68 53 0 58 3 Mmc1_0910 UPF0434 protein Mmc1_0910 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A9BWI3 3.04e-16 67 58 0 53 3 Daci_3569 UPF0434 protein Daci_3569 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q2T0K2 3.04e-16 68 59 0 52 3 BTH_I0741 UPF0434 protein BTH_I0741 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q12M48 3.05e-16 67 60 0 53 3 Sden_2197 UPF0434 protein Sden_2197 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7VVB1 4.06e-16 67 52 0 53 3 BP2767 UPF0434 protein BP2767 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7F8 4.06e-16 67 52 0 53 3 BPP2562 UPF0434 protein BPP2562 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKU6 4.06e-16 67 52 0 53 1 BB2007 UPF0434 protein BB2007 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C1DR20 4.68e-16 67 57 0 57 3 Avin_14770 UPF0434 protein Avin_14770 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A0Q5Q9 4.95e-16 67 47 0 57 3 FTN_0682 UPF0434 protein FTN_0682 Francisella tularensis subsp. novicida (strain U112)
A7NDA9 4.95e-16 67 47 0 57 3 FTA_1487 UPF0434 protein FTA_1487 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NEX7 4.95e-16 67 47 0 57 3 FTT_1479c UPF0434 protein FTT_1479c Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GD0 4.95e-16 67 47 0 57 3 FTF1479c UPF0434 protein FTF1479c Francisella tularensis subsp. tularensis (strain FSC 198)
Q2A2J7 4.95e-16 67 47 0 57 3 FTL_1400 UPF0434 protein FTL_1400 Francisella tularensis subsp. holarctica (strain LVS)
Q0BL47 4.95e-16 67 47 0 57 3 FTH_1362 UPF0434 protein FTH_1362 Francisella tularensis subsp. holarctica (strain OSU18)
A4VMT4 5.57e-16 67 57 0 57 3 PST_2635 UPF0434 protein PST_2635 Stutzerimonas stutzeri (strain A1501)
C5CKW1 6.77e-16 67 58 0 53 3 Vapar_2640 UPF0434 protein Vapar_2640 Variovorax paradoxus (strain S110)
A3N6K6 6.92e-16 67 57 0 52 3 BURPS668_0926 UPF0434 protein BURPS668_0926 Burkholderia pseudomallei (strain 668)
A3NS89 7.31e-16 67 57 0 52 3 BURPS1106A_0929 UPF0434 protein BURPS1106A_0929 Burkholderia pseudomallei (strain 1106a)
Q63WL4 7.31e-16 67 57 0 52 3 BPSL0877 UPF0434 protein BPSL0877 Burkholderia pseudomallei (strain K96243)
A3MN46 7.31e-16 67 57 0 52 3 BMA10247_2152 UPF0434 protein BMA10247_2152 Burkholderia mallei (strain NCTC 10247)
A2S514 7.31e-16 67 57 0 52 3 BMA10229_A1047 UPF0434 protein BMA10229_A1047 Burkholderia mallei (strain NCTC 10229)
A1V115 7.31e-16 67 57 0 52 3 BMASAVP1_A0570 UPF0434 protein BMASAVP1_A0570 Burkholderia mallei (strain SAVP1)
Q62HI3 7.31e-16 67 57 0 52 3 BMA2274 UPF0434 protein BMA2274 Burkholderia mallei (strain ATCC 23344)
Q3JVA9 7.31e-16 67 57 0 52 3 BURPS1710b_1082 UPF0434 protein BURPS1710b_1082 Burkholderia pseudomallei (strain 1710b)
A4SL69 1.01e-15 66 56 0 57 3 ASA_1553 UPF0434 protein ASA_1553 Aeromonas salmonicida (strain A449)
A4G7Y0 1.17e-15 66 54 0 53 3 HEAR2489 UPF0434 protein HEAR2489 Herminiimonas arsenicoxydans
Q0I2X6 1.33e-15 66 51 0 56 3 HS_0657 UPF0434 protein HS_0657 Histophilus somni (strain 129Pt)
A5W727 1.4e-15 66 54 0 57 3 Pput_3813 UPF0434 protein Pput_3813 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88LM8 1.4e-15 66 54 0 57 3 PP_1901 UPF0434 protein PP_1901 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B1J507 1.4e-15 66 54 0 57 3 PputW619_1512 UPF0434 protein PputW619_1512 Pseudomonas putida (strain W619)
B0KF42 1.4e-15 66 54 0 57 3 PputGB1_1477 UPF0434 protein PputGB1_1477 Pseudomonas putida (strain GB-1)
Q1ID00 1.51e-15 66 56 0 53 3 PSEEN1604 UPF0434 protein PSEEN1604 Pseudomonas entomophila (strain L48)
Q8XWE3 1.55e-15 66 57 0 52 3 RSc2531 UPF0434 protein RSc2531 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A0KLY0 2.18e-15 65 56 0 57 3 AHA_2776 UPF0434 protein AHA_2776 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q13DZ7 2.27e-15 65 52 0 53 3 RPD_0454 UPF0434 protein RPD_0454 Rhodopseudomonas palustris (strain BisB5)
B0UT78 2.5e-15 65 51 0 56 3 HSM_0997 UPF0434 protein HSM_0997 Histophilus somni (strain 2336)
Q2J3F5 2.5e-15 65 52 0 53 3 RPB_0294 UPF0434 protein RPB_0294 Rhodopseudomonas palustris (strain HaA2)
Q9ABW2 2.53e-15 65 52 0 53 3 CC_0108 UPF0434 protein CC_0108 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8GXJ8 2.53e-15 65 52 0 53 3 CCNA_00107 UPF0434 protein CCNA_00107 Caulobacter vibrioides (strain NA1000 / CB15N)
A2SIQ2 4.24e-15 65 52 0 53 3 Mpe_A2486 UPF0434 protein Mpe_A2486 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B6J8F9 4.39e-15 64 56 0 53 3 CbuK_1382 UPF0434 protein CbuK_1382 Coxiella burnetii (strain CbuK_Q154)
A4WWL8 5.68e-15 64 50 0 53 3 Rsph17025_2896 UPF0434 protein Rsph17025_2896 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1STC9 5.87e-15 64 56 0 57 3 Ping_0902 UPF0434 protein Ping_0902 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B9KRC9 6.41e-15 64 52 0 53 3 RSKD131_2883 UPF0434 protein RSKD131_2883 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J6F2 6.41e-15 64 52 0 53 3 RHOS4_00640 UPF0434 protein RHOS4_00640 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B2SG50 6.45e-15 64 45 0 57 3 FTM_0733 UPF0434 protein FTM_0733 Francisella tularensis subsp. mediasiatica (strain FSC147)
A1WSH4 6.66e-15 69 59 0 57 3 lpxK Tetraacyldisaccharide 4'-kinase Verminephrobacter eiseniae (strain EF01-2)
Q0BWC7 8.61e-15 64 51 0 58 3 HNE_3545 UPF0434 protein HNE_3545 Hyphomonas neptunium (strain ATCC 15444)
A3PFZ5 1.04e-14 63 52 0 53 3 Rsph17029_0141 UPF0434 protein Rsph17029_0141 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B3Q881 1.28e-14 63 50 0 53 3 Rpal_0270 UPF0434 protein Rpal_0270 Rhodopseudomonas palustris (strain TIE-1)
Q6ND40 1.28e-14 63 50 0 53 3 RPA0269 UPF0434 protein RPA0269 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3YSX3 1.34e-14 63 50 0 53 3 Ecaj_0131 UPF0434 protein Ecaj_0131 Ehrlichia canis (strain Jake)
B1Y6I5 1.38e-14 63 46 1 60 3 Lcho_2556 UPF0434 protein Lcho_2556 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q07UL7 1.47e-14 63 49 0 53 3 RPE_0408 UPF0434 protein RPE_0408 Rhodopseudomonas palustris (strain BisA53)
Q21CP5 1.5e-14 63 49 0 53 3 RPC_0266 UPF0434 protein RPC_0266 Rhodopseudomonas palustris (strain BisB18)
B3PR35 1.57e-14 63 50 0 53 3 RHECIAT_CH0004260 UPF0434 protein RHECIAT_CH0004260 Rhizobium etli (strain CIAT 652)
B6J1K1 1.97e-14 63 54 0 53 3 CbuG_1535 UPF0434 protein CbuG_1535 Coxiella burnetii (strain CbuG_Q212)
Q2GHR5 2.02e-14 63 50 0 53 3 ECH_0194 UPF0434 protein ECH_0194 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q2GLR6 2.16e-14 63 54 0 53 3 APH_0052 UPF0434 protein APH_0052 Anaplasma phagocytophilum (strain HZ)
Q9HZM4 2.4e-14 63 54 0 57 3 PA2980 UPF0434 protein PA2980 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PE3 2.4e-14 63 54 0 57 3 PA14_25520 UPF0434 protein PA14_25520 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V148 2.4e-14 63 54 0 57 3 PLES_20821 UPF0434 protein PLES_20821 Pseudomonas aeruginosa (strain LESB58)
Q8U9N0 2.41e-14 63 49 0 53 3 Atu3696 UPF0434 protein Atu3696 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q492T1 2.48e-14 62 52 0 53 3 BPEN_388 UPF0434 protein BPEN_388 Blochmanniella pennsylvanica (strain BPEN)
Q5LMZ1 2.54e-14 63 50 0 53 3 SPO3421 UPF0434 protein SPO3421 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5QU38 4.19e-14 62 50 0 57 3 IL1511 UPF0434 protein IL1511 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1MAI6 4.7e-14 62 49 0 53 3 RL4569 UPF0434 protein RL4569 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZTJ9 5.24e-14 62 49 0 53 3 Rleg2_3773 UPF0434 protein Rleg2_3773 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q28VC1 5.72e-14 62 50 0 53 3 Jann_0424 UPF0434 protein Jann_0424 Jannaschia sp. (strain CCS1)
A6V3B8 5.9e-14 62 54 0 57 3 PSPA7_2181 UPF0434 protein PSPA7_2181 Pseudomonas aeruginosa (strain PA7)
Q2KZE7 5.93e-14 62 52 0 53 3 BAV2101 UPF0434 protein BAV2101 Bordetella avium (strain 197N)
Q5FSV8 6.01e-14 62 47 0 53 3 GOX0764 UPF0434 protein GOX0764 Gluconobacter oxydans (strain 621H)
Q0AKH3 6.06e-14 62 54 0 53 3 Mmar10_2939 UPF0434 protein Mmar10_2939 Maricaulis maris (strain MCS10)
Q98E33 6.65e-14 62 50 0 53 3 msl4429 UPF0434 protein msl4429 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B0UM25 7.2e-14 62 49 0 53 3 M446_0487 UPF0434 protein M446_0487 Methylobacterium sp. (strain 4-46)
B9JCQ5 7.29e-14 62 47 0 53 3 Arad_4458 UPF0434 protein Arad_4458 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2K364 7.53e-14 62 49 0 53 3 RHE_CH03977 UPF0434 protein RHE_CH03977 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5XHH0 7.53e-14 61 54 0 53 3 CBUD_1597.1 UPF0434 protein CBUD_1597.1 Coxiella burnetii (strain Dugway 5J108-111)
B8IPV3 9.47e-14 61 49 0 53 3 Mnod_1613 UPF0434 protein Mnod_1613 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A6VX96 1.08e-13 61 52 0 57 3 Mmwyl1_2153 UPF0434 protein Mmwyl1_2153 Marinomonas sp. (strain MWYL1)
Q31H19 1.12e-13 61 50 0 57 3 Tcr_0959 UPF0434 protein Tcr_0959 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5E8U9 1.23e-13 61 49 0 53 3 BBta_0300 UPF0434 protein BBta_0300 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q92L94 1.26e-13 61 47 0 53 3 R03186 UPF0434 protein R03186 Rhizobium meliloti (strain 1021)
C5BMQ2 1.34e-13 61 49 0 57 3 TERTU_2813 UPF0434 protein TERTU_2813 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A6UDZ3 1.49e-13 61 47 0 53 3 Smed_3047 UPF0434 protein Smed_3047 Sinorhizobium medicae (strain WSM419)
A4YK44 1.51e-13 61 49 0 53 3 BRADO0313 UPF0434 protein BRADO0313 Bradyrhizobium sp. (strain ORS 278)
Q89WS6 2.01e-13 60 47 0 53 3 bsr0601 UPF0434 protein bsr0601 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1IQS5 2.22e-13 60 45 0 57 1 NMA0874 UPF0434 protein NMA0874 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7DDM0 2.22e-13 60 45 0 57 3 NMB0674 UPF0434 protein NMB0674 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RJR8 2.22e-13 60 45 0 57 3 NGK_0378 UPF0434 protein NGK_0378 Neisseria gonorrhoeae (strain NCCP11945)
Q5F9Z0 2.22e-13 60 45 0 57 3 NGO0244 UPF0434 protein NGO0244 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5VVG4 2.24e-13 60 50 0 53 3 BOV_A0835 UPF0434 protein BOV_A0835 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8FVF2 2.26e-13 60 50 0 53 3 BRA0891 UPF0434 protein BRA0891/BS1330_II0884 Brucella suis biovar 1 (strain 1330)
A9MCH2 2.26e-13 60 50 0 53 3 BCAN_B0909 UPF0434 protein BCAN_B0909 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YCX5 2.26e-13 60 50 0 53 3 BMEII0403 UPF0434 protein BMEII0403 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9WVQ6 2.26e-13 60 50 0 53 3 BSUIS_B0883 UPF0434 protein BSUIS_B0883 Brucella suis (strain ATCC 23445 / NCTC 10510)
B2SAE8 2.26e-13 60 50 0 53 3 BAbS19_II03260 UPF0434 protein BAbS19_II03260 Brucella abortus (strain S19)
C0RM38 2.26e-13 60 50 0 53 3 BMEA_B0871 UPF0434 protein BMEA_B0871 Brucella melitensis biotype 2 (strain ATCC 23457)
Q2YL59 2.26e-13 60 50 0 53 3 BAB2_0345 UPF0434 protein BAB2_0345 Brucella abortus (strain 2308)
Q579B2 2.26e-13 60 50 0 53 3 BruAb2_0341 UPF0434 protein BruAb2_0341 Brucella abortus biovar 1 (strain 9-941)
Q0BVK2 2.6e-13 60 53 0 54 3 GbCGDNIH1_0252 UPF0434 protein GbCGDNIH1_0252 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B9JUE9 3.31e-13 60 43 0 53 3 Avi_4243 UPF0434 protein Avi_4243 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B4RYE3 3.32e-13 60 45 0 57 3 MADE_1009415 UPF0434 protein MADE_1009415 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q0VMP7 3.61e-13 60 50 0 58 3 ABO_2103 UPF0434 protein ABO_2103 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QX67 3.9e-13 60 47 0 57 3 Csal_1588 UPF0434 protein Csal_1588 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QS13 3.93e-13 60 47 0 53 3 Nham_0083 UPF0434 protein Nham_0083 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A9H298 4.32e-13 60 49 0 55 3 GDI0182 UPF0434 protein GDI0182/Gdia_2252 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A9M2V6 4.43e-13 59 45 0 57 3 NMCC_0628 UPF0434 protein NMCC_0628 Neisseria meningitidis serogroup C (strain 053442)
A1UTQ7 5.13e-13 59 44 0 52 3 BARBAKC583_1098 UPF0434 protein BARBAKC583_1098 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A6X438 5.33e-13 59 50 0 53 3 Oant_3286 UPF0434 protein Oant_3286 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q65U19 5.65e-13 59 54 0 53 3 MS0934 UPF0434 protein MS0934 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q11D83 6.04e-13 59 52 0 53 3 Meso_3270 UPF0434 protein Meso_3270 Chelativorans sp. (strain BNC1)
A1KST5 6.58e-13 59 47 0 53 3 NMC0623 UPF0434 protein NMC0623 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q21L70 7.63e-13 59 49 0 57 3 Sde_1297 UPF0434 protein Sde_1297 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1K5I3 8.22e-13 59 60 0 45 3 azo1471 UPF0434 protein azo1471 Azoarcus sp. (strain BH72)
C3M9Z9 8.32e-13 59 45 0 53 3 NGR_c31900 UPF0434 protein NGR_c31900 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5HC42 1.26e-12 58 47 0 53 3 Erum1340 UPF0434 protein Erum1340/ERWE_CDS_01300 Ehrlichia ruminantium (strain Welgevonden)
Q5FFA6 1.26e-12 58 47 0 53 3 ERGA_CDS_01260 UPF0434 protein ERGA_CDS_01260 Ehrlichia ruminantium (strain Gardel)
Q15UY5 1.29e-12 58 53 1 60 3 Patl_1782 UPF0434 protein Patl_1782 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3SWJ8 1.83e-12 58 50 0 52 3 Nwi_0075 UPF0434 protein Nwi_0075 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q5PBU4 2.24e-12 58 49 0 53 3 AM070 UPF0434 protein AM070 Anaplasma marginale (strain St. Maries)
A1U1F4 2.97e-12 57 47 0 57 3 Maqu_1739 UPF0434 protein Maqu_1739 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9CMG9 3.56e-12 57 49 0 53 3 PM0859 UPF0434 protein PM0859 Pasteurella multocida (strain Pm70)
A1B4L5 4.31e-12 57 46 0 52 3 Pden_2369 UPF0434 protein Pden_2369 Paracoccus denitrificans (strain Pd 1222)
Q6FYZ3 6.94e-12 57 42 0 56 3 BQ10150 UPF0434 protein BQ10150 Bartonella quintana (strain Toulouse)
Q16E16 9.16e-12 56 49 0 53 3 RD1_0037 UPF0434 protein RD1_0037 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6G2E7 1.03e-11 56 44 0 52 3 BH12860 UPF0434 protein BH12860 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1LTK8 1.22e-11 56 52 1 55 3 BCI_0256 UPF0434 protein BCI_0256 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8D2V0 2.24e-11 55 46 0 50 3 WIGBR2520 UPF0434 protein WIGBR2520 Wigglesworthia glossinidia brevipalpis
Q1GKM7 5.72e-11 54 43 0 53 3 TM1040_0056 UPF0434 protein TM1040_0056 Ruegeria sp. (strain TM1040)
Q7VR46 1.33e-09 51 41 0 53 3 Bfl377 UPF0434 protein Bfl377 Blochmanniella floridana
A5CVZ8 1.5e-06 43 45 1 53 3 COSY_0767 UPF0434 protein COSY_0767 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2T9V7 0.000162 39 37 0 51 3 PREY Protein preY, mitochondrial Bos taurus
Q5M8Z2 0.000202 39 35 0 51 2 pyurf Protein preY, mitochondrial Xenopus tropicalis
Q96I23 0.000422 38 37 0 51 1 PYURF Protein preY, mitochondrial Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_09610
Feature type CDS
Gene trm112
Product RNA methyltransferase activator Trm112/YbaR
Location 73535 - 73711 (strand: -1)
Length 177 (nucleotides) / 58 (amino acids)
In genomic island -

Contig

Accession ZDB_366
Length 191897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1293
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03966 Trm112p-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2835 Translation, ribosomal structure and biogenesis (J) J RNA methyltransferase activator Trm112/YbaR

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09791 uncharacterized protein - -

Protein Sequence

MDHRLLEIVACPVCHGKLSYDKQNLELICKGCRLAYPVRDDIPVLLENEARELPVSEG

Flanking regions ( +/- flanking 50bp)

ACCGGGCTTATGTTATTCTGAGCCAACGTTTTTATCTCATTGGGGGACGTATGGATCACCGTTTACTCGAAATCGTGGCCTGCCCTGTTTGCCACGGCAAACTCAGCTACGACAAGCAAAATCTCGAACTCATCTGCAAAGGCTGCCGTCTGGCCTATCCCGTCCGCGACGATATCCCTGTCTTATTAGAGAATGAAGCCCGCGAATTGCCGGTCTCAGAAGGATAATCTCCATGTTTACAGTTATCATTCCTGCGCGTTATGCCTCCACGCGTCTG