Homologs in group_2776

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07980 FBDBKF_07980 100.0 Morganella morganii S1 - AprI/Inh family metalloprotease inhibitor
EHELCC_13810 EHELCC_13810 100.0 Morganella morganii S2 - AprI/Inh family metalloprotease inhibitor
NLDBIP_14255 NLDBIP_14255 100.0 Morganella morganii S4 - AprI/Inh family metalloprotease inhibitor
HKOGLL_08145 HKOGLL_08145 100.0 Morganella morganii S5 - AprI/Inh family metalloprotease inhibitor
F4V73_RS13005 F4V73_RS13005 58.8 Morganella psychrotolerans - AprI/Inh family metalloprotease inhibitor

Distribution of the homologs in the orthogroup group_2776

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2776

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q54478 8.02e-05 42 27 3 112 1 inh Alkaline proteinase inhibitor Serratia marcescens
P18958 9.78e-05 42 32 3 95 1 inh Proteinase inhibitor Dickeya chrysanthemi
Q03026 0.000501 40 27 4 114 1 inh Proteinase inhibitor Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7N8R2 0.000548 40 28 3 102 3 inh Alkaline proteinase inhibitor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_08595
Feature type CDS
Gene -
Product AprI/Inh family metalloprotease inhibitor
Location 36520 - 36870 (strand: -1)
Length 351 (nucleotides) / 116 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2776
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02974 Protease inhibitor Inh

Protein Sequence

MYISQSSLLLFSLLLSGQSAAISQKIPAAEDLQGNWKFTEDGQTQPVTLIAVPDKTTEGFQLHFTAQPQITAWRPAPDGIAFLTADGTTRYFFSAEAPGRYRAEIWHENGACLLKE

Flanking regions ( +/- flanking 50bp)

CAGCAGGCGGGCGCGGCCGGTGCGGCGTCCGCAGCATTCAGGAAGGTATTATGTATATCAGTCAATCATCATTGTTATTGTTTTCACTGCTGTTATCCGGACAGAGTGCGGCAATCAGCCAGAAAATTCCCGCCGCAGAAGATCTTCAGGGCAACTGGAAGTTTACGGAGGACGGGCAGACACAGCCCGTCACACTGATAGCGGTTCCTGATAAAACCACTGAAGGATTTCAGCTGCACTTCACGGCACAGCCGCAGATAACGGCCTGGCGTCCGGCGCCGGACGGCATTGCGTTTCTTACTGCAGACGGCACCACACGTTATTTCTTTTCCGCCGAAGCCCCCGGCCGTTACCGCGCGGAAATCTGGCATGAAAATGGCGCCTGTCTTCTGAAAGAGTAATTACCTCTCTTTTTTACTTGGTGAACAATATTATCAATCCCGGCAGACAT