Homologs in group_1115

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05925 FBDBKF_05925 100.0 Morganella morganii S1 tilS tRNA(Ile)-lysidine synthase TilS/MesJ
EHELCC_08970 EHELCC_08970 100.0 Morganella morganii S2 tilS tRNA(Ile)-lysidine synthase TilS/MesJ
NLDBIP_09350 NLDBIP_09350 100.0 Morganella morganii S4 tilS tRNA(Ile)-lysidine synthase TilS/MesJ
HKOGLL_07955 HKOGLL_07955 100.0 Morganella morganii S5 tilS tRNA(Ile)-lysidine synthase TilS/MesJ
F4V73_RS15970 F4V73_RS15970 73.0 Morganella psychrotolerans tilS tRNA lysidine(34) synthetase TilS
PMI_RS11195 PMI_RS11195 52.0 Proteus mirabilis HI4320 tilS tRNA lysidine(34) synthetase TilS

Distribution of the homologs in the orthogroup group_1115

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1115

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8N0 4.75e-161 465 53 1 433 3 tilS tRNA(Ile)-lysidine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7FFI7 5.59e-147 429 54 2 425 3 tilS tRNA(Ile)-lysidine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q667K7 6.14e-147 430 54 2 425 3 tilS tRNA(Ile)-lysidine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZH50 6.77e-147 430 54 2 425 3 tilS tRNA(Ile)-lysidine synthase Yersinia pestis
B4F252 4.45e-145 424 51 4 443 3 tilS tRNA(Ile)-lysidine synthase Proteus mirabilis (strain HI4320)
C5B7T0 1.61e-141 415 52 1 416 3 tilS tRNA(Ile)-lysidine synthase Edwardsiella ictaluri (strain 93-146)
Q8FL00 2.84e-137 404 52 3 425 3 tilS tRNA(Ile)-lysidine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P52097 6.54e-137 403 51 3 426 1 tilS tRNA(Ile)-lysidine synthase Escherichia coli (strain K12)
Q6D8C5 3.05e-135 399 53 4 426 3 tilS tRNA(Ile)-lysidine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7UDQ6 1.99e-134 397 51 3 426 3 tilS tRNA(Ile)-lysidine synthase Shigella flexneri
Q8X8W8 2.27e-133 394 50 4 438 3 tilS tRNA(Ile)-lysidine synthase Escherichia coli O157:H7
A8GIC1 1.8e-132 392 52 4 431 3 tilS tRNA(Ile)-lysidine synthase Serratia proteamaculans (strain 568)
A9N0U0 2.54e-131 389 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8ZRN5 3.09e-131 389 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SV18 3.44e-131 389 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella newport (strain SL254)
B4TYE9 1.23e-130 387 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella schwarzengrund (strain CVM19633)
B5F8V0 4.06e-130 386 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella agona (strain SL483)
Q8Z996 4.57e-130 385 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella typhi
Q5PD76 2.49e-129 384 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57T19 2.63e-129 384 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella choleraesuis (strain SC-B67)
B4TK64 2.69e-129 384 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella heidelberg (strain SL476)
B5FJ36 6.27e-129 383 50 3 415 3 tilS tRNA(Ile)-lysidine synthase Salmonella dublin (strain CT_02021853)
C4K338 4.92e-127 379 45 6 445 3 tilS tRNA(Ile)-lysidine synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A4W6T3 3.23e-126 376 50 5 422 3 tilS tRNA(Ile)-lysidine synthase Enterobacter sp. (strain 638)
A5UA84 1.25e-112 341 44 8 417 3 tilS tRNA(Ile)-lysidine synthase Haemophilus influenzae (strain PittEE)
A5UGS0 1.73e-112 341 44 6 416 3 tilS tRNA(Ile)-lysidine synthase Haemophilus influenzae (strain PittGG)
P44689 3.98e-112 340 44 7 416 3 tilS tRNA(Ile)-lysidine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VRC9 3.14e-111 341 40 9 472 3 tilS tRNA(Ile)-lysidine synthase Blochmanniella floridana
Q4QND8 2.36e-110 335 43 5 415 3 tilS tRNA(Ile)-lysidine synthase Haemophilus influenzae (strain 86-028NP)
Q493B5 2.05e-109 336 40 12 467 3 tilS tRNA(Ile)-lysidine synthase Blochmanniella pennsylvanica (strain BPEN)
Q8DBE4 1.9e-107 328 42 5 437 3 tilS tRNA(Ile)-lysidine synthase Vibrio vulnificus (strain CMCP6)
Q9CNY2 2.56e-107 328 43 5 417 3 tilS tRNA(Ile)-lysidine synthase Pasteurella multocida (strain Pm70)
Q7MIH8 4.45e-107 327 42 5 437 3 tilS tRNA(Ile)-lysidine synthase Vibrio vulnificus (strain YJ016)
A6VNE4 1.82e-105 323 43 4 410 3 tilS tRNA(Ile)-lysidine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B7VIQ1 1.37e-103 319 42 7 454 3 tilS tRNA(Ile)-lysidine synthase Vibrio atlanticus (strain LGP32)
Q65UE9 1.56e-103 318 44 5 408 3 tilS tRNA(Ile)-lysidine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6LN41 1.57e-101 313 43 5 417 3 tilS tRNA(Ile)-lysidine synthase Photobacterium profundum (strain SS9)
A3N2I9 5.45e-100 308 44 7 420 3 tilS tRNA(Ile)-lysidine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I3D1 1.21e-99 308 43 7 415 3 tilS tRNA(Ile)-lysidine synthase Histophilus somni (strain 129Pt)
B0BRD5 6.39e-99 306 43 7 420 3 tilS tRNA(Ile)-lysidine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYM3 6.39e-99 306 43 7 420 3 tilS tRNA(Ile)-lysidine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q87MF4 2.33e-97 302 41 4 437 3 tilS tRNA(Ile)-lysidine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0UUD3 1.02e-95 298 41 5 417 3 tilS tRNA(Ile)-lysidine synthase Histophilus somni (strain 2336)
A7MXZ8 4.32e-95 297 40 6 448 3 tilS tRNA(Ile)-lysidine synthase Vibrio campbellii (strain ATCC BAA-1116)
Q8KA23 1.11e-92 290 33 4 418 3 tilS tRNA(Ile)-lysidine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q83BJ9 3.04e-90 284 38 7 423 3 tilS tRNA(Ile)-lysidine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P57211 1.47e-88 280 33 3 421 3 tilS tRNA(Ile)-lysidine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C3LPP6 1.38e-86 275 38 6 448 3 tilS tRNA(Ile)-lysidine synthase Vibrio cholerae serotype O1 (strain M66-2)
A5F623 1.38e-86 275 38 6 448 3 tilS tRNA(Ile)-lysidine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KPX0 1.12e-85 272 38 6 448 3 tilS tRNA(Ile)-lysidine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7VPN7 9.41e-81 259 38 6 411 3 tilS tRNA(Ile)-lysidine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8EGF9 1.63e-78 254 39 14 440 3 tilS tRNA(Ile)-lysidine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5WYB4 3.03e-77 250 36 6 409 3 tilS tRNA(Ile)-lysidine synthase Legionella pneumophila (strain Lens)
B1KNS7 7.65e-77 250 39 11 429 3 tilS tRNA(Ile)-lysidine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q5ZXE5 4.13e-74 242 36 8 409 3 tilS tRNA(Ile)-lysidine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6W4 6.66e-74 241 36 8 409 3 tilS tRNA(Ile)-lysidine synthase Legionella pneumophila (strain Paris)
Q89AX3 4.98e-73 239 31 5 419 3 tilS tRNA(Ile)-lysidine synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D2F5 9.5e-73 238 37 2 316 3 tilS tRNA(Ile)-lysidine synthase Wigglesworthia glossinidia brevipalpis
Q607F5 8.83e-71 233 37 10 419 3 tilS tRNA(Ile)-lysidine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8P7L3 2.2e-63 214 37 4 409 3 tilS tRNA(Ile)-lysidine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWI7 2.2e-63 214 37 4 409 3 tilS tRNA(Ile)-lysidine synthase Xanthomonas campestris pv. campestris (strain 8004)
Q9HXZ3 6.85e-62 210 36 10 433 3 tilS tRNA(Ile)-lysidine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88MG3 2.28e-61 209 37 11 413 3 tilS tRNA(Ile)-lysidine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5R0Q7 2.35e-61 209 32 12 449 3 tilS tRNA(Ile)-lysidine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q886M6 6.67e-61 208 38 13 412 3 tilS tRNA(Ile)-lysidine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q82VP4 1.68e-60 207 33 10 413 3 tilS tRNA(Ile)-lysidine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7NT72 8.74e-59 202 36 10 425 3 tilS tRNA(Ile)-lysidine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8PIY5 1.77e-57 199 37 8 418 3 tilS tRNA(Ile)-lysidine synthase Xanthomonas axonopodis pv. citri (strain 306)
Q31G65 7.9e-56 194 32 9 425 3 tilS tRNA(Ile)-lysidine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3KH95 2.66e-54 190 36 12 412 3 tilS tRNA(Ile)-lysidine synthase Pseudomonas fluorescens (strain Pf0-1)
Q4W568 4.68e-54 189 37 7 359 3 tilS1 tRNA(Ile)-lysidine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JUE9 4.68e-54 189 37 7 359 3 tilS tRNA(Ile)-lysidine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F8F6 1.39e-53 189 36 11 386 3 tilS tRNA(Ile)-lysidine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q0A7K1 2.6e-51 182 35 8 437 3 tilS tRNA(Ile)-lysidine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6F880 5.47e-50 179 32 7 414 3 tilS tRNA(Ile)-lysidine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q87BE2 2.83e-49 177 36 10 425 3 tilS tRNA(Ile)-lysidine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PFJ8 1.2e-47 172 37 11 414 3 tilS tRNA(Ile)-lysidine synthase Xylella fastidiosa (strain 9a5c)
B0TYH9 1.1e-42 158 27 12 413 3 tilS tRNA(Ile)-lysidine synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A0Q7B6 9.94e-41 153 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. novicida (strain U112)
Q5P2I9 1.01e-40 154 31 12 432 3 tilS tRNA(Ile)-lysidine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q63ST1 1.3e-40 154 41 6 280 3 tilS tRNA(Ile)-lysidine synthase Burkholderia pseudomallei (strain K96243)
Q62J40 4.57e-40 153 41 6 280 3 tilS tRNA(Ile)-lysidine synthase Burkholderia mallei (strain ATCC 23344)
Q8Y074 7.18e-40 152 33 11 438 3 tilS tRNA(Ile)-lysidine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2SG31 1.83e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
A1K3X8 1.99e-39 150 33 20 430 3 tilS tRNA(Ile)-lysidine synthase Azoarcus sp. (strain BH72)
A4IXE6 2.23e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFK3 2.23e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H05 2.23e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BMM2 3.31e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A488 3.31e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NB76 3.31e-39 149 26 9 413 3 tilS tRNA(Ile)-lysidine synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q839B3 2.2e-31 129 32 4 240 3 tilS tRNA(Ile)-lysidine synthase Enterococcus faecalis (strain ATCC 700802 / V583)
A2SIL9 5.69e-30 124 30 12 438 3 tilS tRNA(Ile)-lysidine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q5GTD2 6.59e-29 121 36 4 187 3 tilS tRNA(Ile)-lysidine synthase Wolbachia sp. subsp. Brugia malayi (strain TRS)
A1VRB1 2e-28 117 33 5 270 3 tilS tRNA(Ile)-lysidine synthase Polaromonas naphthalenivorans (strain CJ2)
B3CLY6 2.08e-28 119 36 3 188 3 tilS tRNA(Ile)-lysidine synthase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q73FR9 2.12e-28 119 35 4 195 3 tilS tRNA(Ile)-lysidine synthase Wolbachia pipientis wMel
Q724J4 6.22e-28 120 27 13 417 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serotype 4b (strain F2365)
Q88Z33 8.43e-28 118 33 4 218 3 tilS tRNA(Ile)-lysidine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C0R4S1 1.21e-27 117 35 5 201 3 tilS tRNA(Ile)-lysidine synthase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q8YAC7 3.24e-27 118 26 12 417 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B1YGQ4 8.13e-27 115 34 4 212 3 tilS tRNA(Ile)-lysidine synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q92F56 1.78e-26 116 29 6 312 3 tilS/hprT Bifunctional protein TilS/HprT Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q01QT2 2.28e-25 111 33 7 221 3 tilS tRNA(Ile)-lysidine synthase Solibacter usitatus (strain Ellin6076)
B7IFR8 3e-25 110 29 6 268 3 tilS tRNA(Ile)-lysidine synthase Thermosipho africanus (strain TCF52B)
C0MC74 3.43e-24 107 32 7 261 3 tilS tRNA(Ile)-lysidine synthase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U5H9 3.43e-24 107 32 7 261 3 tilS tRNA(Ile)-lysidine synthase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MAT4 3.63e-24 107 34 5 218 3 tilS tRNA(Ile)-lysidine synthase Streptococcus equi subsp. equi (strain 4047)
Q5L3T3 1.95e-23 105 30 7 249 1 tilS tRNA(Ile)-lysidine synthase Geobacillus kaustophilus (strain HTA426)
A8B000 2.41e-23 105 33 5 206 3 tilS tRNA(Ile)-lysidine synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P37563 2.55e-23 105 30 4 236 1 tilS tRNA(Ile)-lysidine synthase Bacillus subtilis (strain 168)
Q8KC15 3.15e-23 103 31 10 282 3 tilS tRNA(Ile)-lysidine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5XEL7 8.9e-23 103 28 7 294 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5P9R1 1.04e-22 103 34 3 189 3 tilS tRNA(Ile)-lysidine synthase Anaplasma marginale (strain St. Maries)
Q8P322 1.08e-22 103 28 7 294 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
A8M8I3 1.42e-22 101 37 2 198 3 tilS tRNA(Ile)-lysidine synthase Salinispora arenicola (strain CNS-205)
P0DG01 2.04e-22 102 31 6 233 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG00 2.04e-22 102 31 6 233 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A201 2.18e-22 102 31 6 233 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pyogenes serotype M1
Q72C25 2.46e-22 101 36 5 201 3 tilS tRNA(Ile)-lysidine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O67728 3.21e-22 100 30 6 204 1 tilS tRNA(Ile)-lysidine synthase Aquifex aeolicus (strain VF5)
Q5SI38 3.48e-22 102 33 10 300 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IF6 3.92e-22 102 33 10 300 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B1L8R5 7.24e-22 100 29 6 214 3 tilS tRNA(Ile)-lysidine synthase Thermotoga sp. (strain RQ2)
A5WCA0 7.24e-22 101 25 9 403 3 tilS tRNA(Ile)-lysidine synthase Psychrobacter sp. (strain PRwf-1)
B2RMB4 8.26e-22 100 34 9 221 3 tilS tRNA(Ile)-lysidine synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q5NLX8 8.67e-22 99 32 5 202 3 tilS tRNA(Ile)-lysidine synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q7MTC4 1.06e-21 100 34 9 221 3 tilS tRNA(Ile)-lysidine synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9WZ48 1.09e-21 100 29 6 214 3 tilS tRNA(Ile)-lysidine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6NAQ6 1.59e-21 99 36 4 209 3 tilS tRNA(Ile)-lysidine synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8DWM9 2.07e-21 99 34 5 207 3 tilS tRNA(Ile)-lysidine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5N517 2.36e-21 97 31 6 282 3 tilS tRNA(Ile)-lysidine synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q74C65 2.81e-21 99 33 5 228 3 tilS tRNA(Ile)-lysidine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B8ZJI9 8.28e-21 97 32 8 231 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B2IQZ8 1.19e-20 97 32 8 231 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain CGSP14)
B5E578 1.19e-20 97 32 8 231 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae serotype 19F (strain G54)
C1C992 1.25e-20 97 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain 70585)
Q97TC5 1.27e-20 97 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DRP9 1.28e-20 97 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04N53 1.28e-20 97 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9KGH8 1.53e-20 97 28 3 227 3 tilS tRNA(Ile)-lysidine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A9BJK2 2.35e-20 94 26 5 218 3 tilS tRNA(Ile)-lysidine synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q81VX7 2.97e-20 96 28 10 282 3 tilS tRNA(Ile)-lysidine synthase Bacillus anthracis
Q9XBG6 3.41e-20 95 36 3 197 3 tilS tRNA(Ile)-lysidine synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2NIN4 3.82e-20 95 29 7 206 3 tilS tRNA(Ile)-lysidine synthase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6HPV4 3.91e-20 96 28 10 282 3 tilS tRNA(Ile)-lysidine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1CH91 3.97e-20 95 32 8 231 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain JJA)
Q6YR87 8.57e-20 94 29 4 194 3 tilS tRNA(Ile)-lysidine synthase Onion yellows phytoplasma (strain OY-M)
B1I6Y3 9.42e-20 94 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain Hungary19A-6)
C1CN76 9.87e-20 94 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain P1031)
C1CNP4 1.01e-19 94 33 7 201 3 tilS tRNA(Ile)-lysidine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
Q8CQV3 1.15e-19 94 24 13 426 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP5 1.15e-19 94 24 13 426 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q73FE5 1.34e-19 94 28 10 282 3 tilS tRNA(Ile)-lysidine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81J84 1.7e-19 94 28 11 282 3 tilS tRNA(Ile)-lysidine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7W859 1.73e-19 92 32 6 298 3 tilS tRNA(Ile)-lysidine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WLK7 1.73e-19 92 33 6 298 3 tilS tRNA(Ile)-lysidine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5M6K9 2.54e-19 93 28 7 303 3 tilS tRNA(Ile)-lysidine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M217 2.54e-19 93 28 7 303 3 tilS tRNA(Ile)-lysidine synthase Streptococcus thermophilus (strain CNRZ 1066)
Q8DIH2 3.61e-19 92 33 5 215 3 tilS tRNA(Ile)-lysidine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q63HD6 3.81e-19 93 27 10 282 3 tilS tRNA(Ile)-lysidine synthase Bacillus cereus (strain ZK / E33L)
Q8E2H4 4.12e-19 92 32 6 210 3 tilS tRNA(Ile)-lysidine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y2 4.12e-19 92 32 6 210 3 tilS tRNA(Ile)-lysidine synthase Streptococcus agalactiae serotype III (strain NEM316)
Q6GJG2 5.12e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain MRSA252)
Q7VX92 5.23e-19 90 33 6 292 3 tilS tRNA(Ile)-lysidine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8NXZ4 6.33e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain MW2)
Q6GBX9 6.33e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain MSSA476)
Q9CJH4 7e-19 92 23 17 427 3 tilS tRNA(Ile)-lysidine synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q5HIG6 7.33e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain COL)
Q7A7A6 7.68e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain N315)
Q99W94 7.68e-19 92 27 4 192 3 tilS tRNA(Ile)-lysidine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A8F7F8 9.95e-19 91 29 4 193 3 tilS tRNA(Ile)-lysidine synthase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q97EB0 1.73e-18 91 30 6 193 3 tilS tRNA(Ile)-lysidine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9RV23 2e-18 91 33 7 218 3 tilS tRNA(Ile)-lysidine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6AJ19 2.19e-18 90 33 6 227 3 tilS tRNA(Ile)-lysidine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q92JY3 4.11e-18 90 31 5 203 3 tilS tRNA(Ile)-lysidine synthase Rhizobium meliloti (strain 1021)
Q46ID9 4.2e-18 88 25 11 331 3 tilS tRNA(Ile)-lysidine synthase Prochlorococcus marinus (strain NATL2A)
Q65ZY6 4.22e-18 89 26 6 220 3 tilS tRNA(Ile)-lysidine synthase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A2C5B5 4.61e-18 88 26 12 334 3 tilS tRNA(Ile)-lysidine synthase Prochlorococcus marinus (strain NATL1A)
A3CJX7 4.74e-18 89 31 4 207 3 tilS tRNA(Ile)-lysidine synthase Streptococcus sanguinis (strain SK36)
Q8EU18 5.77e-18 89 24 8 345 3 tilS tRNA(Ile)-lysidine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8YYB8 6.13e-18 88 31 5 215 3 tilS tRNA(Ile)-lysidine synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A6LBU3 8.44e-18 89 30 7 250 3 tilS tRNA(Ile)-lysidine synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q899H5 1.26e-17 88 29 5 203 3 tilS tRNA(Ile)-lysidine synthase Clostridium tetani (strain Massachusetts / E88)
A4XCT1 1.29e-17 87 39 4 199 3 tilS tRNA(Ile)-lysidine synthase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q181G3 1.53e-17 88 29 5 196 3 tilS tRNA(Ile)-lysidine synthase Clostridioides difficile (strain 630)
Q3ZYX5 1.84e-17 88 31 5 225 3 tilS tRNA(Ile)-lysidine synthase Dehalococcoides mccartyi (strain CBDB1)
Q9ZGE2 1.99e-17 87 30 6 222 3 tilS tRNA(Ile)-lysidine synthase Heliobacterium mobile
Q7UNE1 4.98e-17 86 29 7 249 3 tilS tRNA(Ile)-lysidine synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8U9L7 8.2e-17 85 31 6 229 3 tilS tRNA(Ile)-lysidine synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8XHL1 1.44e-16 85 25 9 283 3 tilS tRNA(Ile)-lysidine synthase Clostridium perfringens (strain 13 / Type A)
Q0SM64 1.47e-16 85 25 5 219 3 tilS tRNA(Ile)-lysidine synthase Borreliella afzelii (strain PKo)
Q0TMI0 1.79e-16 85 25 9 276 3 tilS tRNA(Ile)-lysidine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q65PF4 1.98e-16 85 28 4 222 3 tilS tRNA(Ile)-lysidine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5WAE0 2.31e-16 84 29 5 237 3 tilS tRNA(Ile)-lysidine synthase Shouchella clausii (strain KSM-K16)
Q6ACP8 2.5e-16 83 33 10 274 3 tilS tRNA(Ile)-lysidine synthase Leifsonia xyli subsp. xyli (strain CTCB07)
B3CUJ5 4.13e-16 84 28 7 207 3 tilS tRNA(Ile)-lysidine synthase Orientia tsutsugamushi (strain Ikeda)
Q68XR8 4.76e-16 83 24 9 328 3 tilS tRNA(Ile)-lysidine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UN67 5.22e-16 83 29 3 183 3 tilS tRNA(Ile)-lysidine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q73N15 7.08e-16 83 28 7 214 3 tilS tRNA(Ile)-lysidine synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8R7K9 9.2e-16 82 26 9 263 3 tilS tRNA(Ile)-lysidine synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C0ZNS6 9.21e-16 81 32 11 272 3 tilS tRNA(Ile)-lysidine synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q9ZEA3 9.94e-16 82 28 3 188 3 tilS tRNA(Ile)-lysidine synthase Rickettsia prowazekii (strain Madrid E)
A5CFP2 1.15e-15 82 27 7 207 3 tilS tRNA(Ile)-lysidine synthase Orientia tsutsugamushi (strain Boryong)
C0QU23 1.36e-15 82 22 14 431 3 tilS tRNA(Ile)-lysidine synthase Persephonella marina (strain DSM 14350 / EX-H1)
Q6MLS8 1.59e-15 80 32 5 206 3 tilS tRNA(Ile)-lysidine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C4K162 1.83e-15 82 27 6 242 3 tilS tRNA(Ile)-lysidine synthase Rickettsia peacockii (strain Rustic)
A8GQJ7 2.8e-15 81 28 4 204 3 tilS tRNA(Ile)-lysidine synthase Rickettsia rickettsii (strain Sheila Smith)
B0BVY4 2.8e-15 81 28 4 204 3 tilS tRNA(Ile)-lysidine synthase Rickettsia rickettsii (strain Iowa)
Q0C5V2 3.01e-15 80 30 8 219 3 tilS tRNA(Ile)-lysidine synthase Hyphomonas neptunium (strain ATCC 15444)
Q2JJ74 3.63e-15 79 29 9 302 3 tilS tRNA(Ile)-lysidine synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q92JK0 3.66e-15 80 29 4 200 3 tilS tRNA(Ile)-lysidine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B7J0N4 4.65e-15 80 25 5 218 3 tilS tRNA(Ile)-lysidine synthase Borreliella burgdorferi (strain ZS7)
O51728 4.65e-15 80 25 5 218 3 tilS tRNA(Ile)-lysidine synthase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
C3PM75 4.71e-15 80 29 4 200 3 tilS tRNA(Ile)-lysidine synthase Rickettsia africae (strain ESF-5)
Q64WF9 5.59e-15 80 29 6 231 3 tilS tRNA(Ile)-lysidine synthase Bacteroides fragilis (strain YCH46)
Q2JRN8 5.6e-15 79 31 8 265 3 tilS tRNA(Ile)-lysidine synthase Synechococcus sp. (strain JA-3-3Ab)
A8F0E8 6.03e-15 80 28 3 183 3 tilS tRNA(Ile)-lysidine synthase Rickettsia massiliae (strain Mtu5)
Q046D9 6.52e-15 80 30 9 233 3 tilS tRNA(Ile)-lysidine synthase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q9PL79 7.3e-15 79 26 7 252 3 tilS tRNA(Ile)-lysidine synthase Chlamydia muridarum (strain MoPn / Nigg)
A8GLX9 8.74e-15 79 28 3 183 3 tilS tRNA(Ile)-lysidine synthase Rickettsia akari (strain Hartford)
Q67JG9 8.78e-15 79 31 6 223 3 tilS tRNA(Ile)-lysidine synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2GC97 1.61e-14 77 31 8 229 3 tilS tRNA(Ile)-lysidine synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B2S2X0 2.74e-14 78 33 7 200 3 tilS tRNA(Ile)-lysidine synthase Treponema pallidum subsp. pallidum (strain SS14)
O83388 2.74e-14 78 33 7 200 3 tilS tRNA(Ile)-lysidine synthase Treponema pallidum (strain Nichols)
Q7UZL1 3.04e-14 77 27 4 210 3 tilS tRNA(Ile)-lysidine synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q5FQB6 3.12e-14 77 30 3 182 3 tilS tRNA(Ile)-lysidine synthase Gluconobacter oxydans (strain 621H)
Q822B9 3.75e-14 76 28 3 204 3 tilS tRNA(Ile)-lysidine synthase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9Z6R2 5.06e-14 76 28 6 228 3 tilS tRNA(Ile)-lysidine synthase Chlamydia pneumoniae
P74192 5.79e-14 76 29 9 273 3 tilS tRNA(Ile)-lysidine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8IP16 6.11e-14 76 33 5 196 3 tilS tRNA(Ile)-lysidine synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5L5B2 7.11e-14 75 28 3 199 3 tilS tRNA(Ile)-lysidine synthase Chlamydia abortus (strain DSM 27085 / S26/3)
Q8RHN5 7.35e-14 77 20 15 426 3 tilS tRNA(Ile)-lysidine synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B0BAU8 9.95e-14 75 26 6 241 3 tilS tRNA(Ile)-lysidine synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B969 9.95e-14 75 26 6 241 3 tilS tRNA(Ile)-lysidine synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84847 1.15e-13 75 26 6 241 3 tilS tRNA(Ile)-lysidine synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KKJ9 1.15e-13 75 26 6 241 3 tilS tRNA(Ile)-lysidine synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
A8GY99 1.23e-13 76 28 3 183 3 tilS tRNA(Ile)-lysidine synthase Rickettsia bellii (strain OSU 85-389)
Q1RGN9 1.25e-13 76 28 3 183 3 tilS tRNA(Ile)-lysidine synthase Rickettsia bellii (strain RML369-C)
Q74LA3 1.28e-13 76 29 6 228 3 tilS tRNA(Ile)-lysidine synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A5ERG8 2.66e-13 74 29 4 279 3 tilS tRNA(Ile)-lysidine synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q7V987 3.58e-13 73 26 5 296 3 tilS tRNA(Ile)-lysidine synthase Prochlorococcus marinus (strain MIT 9313)
B7GP48 4.15e-13 74 30 6 212 3 tilS tRNA(Ile)-lysidine synthase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
C1D1Q9 5.32e-13 74 31 7 210 3 tilS tRNA(Ile)-lysidine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q255L6 7.22e-13 72 28 3 199 3 tilS tRNA(Ile)-lysidine synthase Chlamydia felis (strain Fe/C-56)
Q5LNU7 7.32e-13 73 32 5 183 3 tilS tRNA(Ile)-lysidine synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3DR08 1.18e-12 72 30 6 205 3 tilS tRNA(Ile)-lysidine synthase Bifidobacterium longum (strain DJO10A)
Q9PMK7 1.21e-12 72 31 2 133 3 tilS tRNA(Ile)-lysidine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6B8L1 1.65e-12 71 27 5 192 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Gracilaria tenuistipitata var. liui
Q5HSX8 2.04e-12 71 31 2 133 3 tilS tRNA(Ile)-lysidine synthase Campylobacter jejuni (strain RM1221)
Q7V9L9 2.31e-12 71 26 8 296 3 tilS tRNA(Ile)-lysidine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
C1A873 3.92e-12 71 30 6 226 3 tilS tRNA(Ile)-lysidine synthase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q8M9Y1 4.01e-12 70 27 6 224 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Chaetosphaeridium globosum
Q8FMG0 4.23e-12 70 31 8 211 3 tilS tRNA(Ile)-lysidine synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6MDI6 4.4e-12 71 23 4 243 3 tilS tRNA(Ile)-lysidine synthase Protochlamydia amoebophila (strain UWE25)
Q8A7D1 4.44e-12 71 27 7 215 3 tilS tRNA(Ile)-lysidine synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
O69538 4.45e-12 70 31 7 263 3 tilS tRNA(Ile)-lysidine synthase Mycobacterium leprae (strain TN)
Q8G3S4 4.46e-12 70 28 5 210 3 tilS tRNA(Ile)-lysidine synthase Bifidobacterium longum (strain NCC 2705)
Q1ACK8 4.75e-12 70 25 9 282 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Chara vulgaris
Q7VGR5 7.78e-12 70 23 7 252 3 tilS tRNA(Ile)-lysidine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7UA26 1.23e-11 69 30 8 262 3 tilS tRNA(Ile)-lysidine synthase Parasynechococcus marenigrum (strain WH8102)
Q83I94 4.23e-11 68 36 4 133 3 tilS tRNA(Ile)-lysidine synthase Tropheryma whipplei (strain TW08/27)
Q83I94 0.000109 48 35 2 82 3 tilS tRNA(Ile)-lysidine synthase Tropheryma whipplei (strain TW08/27)
Q83MT2 6.87e-11 67 36 4 133 3 tilS tRNA(Ile)-lysidine synthase Tropheryma whipplei (strain Twist)
Q83MT2 0.000118 48 35 2 82 3 tilS tRNA(Ile)-lysidine synthase Tropheryma whipplei (strain Twist)
Q9MUR3 7.28e-11 66 25 7 221 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Mesostigma viride
A6WY85 8.08e-11 67 30 7 262 3 tilS tRNA(Ile)-lysidine synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q98F87 2.02e-10 66 28 3 190 3 tilS tRNA(Ile)-lysidine synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6AB49 2.81e-10 65 32 7 228 3 tilS tRNA(Ile)-lysidine synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q9ZLB5 5.35e-10 64 25 7 217 3 tilS tRNA(Ile)-lysidine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q7NNL0 1.26e-09 63 31 8 261 3 tilS tRNA(Ile)-lysidine synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6NF90 1.96e-09 62 32 7 190 3 tilS tRNA(Ile)-lysidine synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9T390 4.22e-09 61 28 7 243 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Nephroselmis olivacea
Q72W10 4.53e-09 62 29 8 205 3 tilS tRNA(Ile)-lysidine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q04XC4 4.55e-09 62 26 7 213 3 tilS tRNA(Ile)-lysidine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04W48 4.55e-09 62 26 7 213 3 tilS tRNA(Ile)-lysidine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q8F9P6 6.12e-09 61 29 8 205 3 tilS tRNA(Ile)-lysidine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
C5BYK3 9.02e-09 60 34 6 183 3 tilS tRNA(Ile)-lysidine synthase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q6F0E4 1.61e-08 60 23 5 183 3 tilS tRNA(Ile)-lysidine synthase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9X8I6 3.27e-08 58 34 7 234 3 tilS tRNA(Ile)-lysidine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B0UGN1 3.36e-08 58 30 3 167 3 tilS tRNA(Ile)-lysidine synthase Methylobacterium sp. (strain 4-46)
Q601M6 4.44e-08 58 23 4 186 3 tilS tRNA(Ile)-lysidine synthase Mesomycoplasma hyopneumoniae (strain 232)
C1BA63 6.67e-08 57 30 8 231 3 tilS tRNA(Ile)-lysidine synthase Rhodococcus opacus (strain B4)
Q744A3 8.82e-08 57 32 9 264 3 tilS tRNA(Ile)-lysidine synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q47KU2 1.01e-07 57 32 6 206 3 tilS tRNA(Ile)-lysidine synthase Thermobifida fusca (strain YX)
Q82EF1 1.3e-07 57 34 7 217 3 tilS tRNA(Ile)-lysidine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6MUI9 1.76e-07 57 23 5 186 3 tilS tRNA(Ile)-lysidine synthase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
O25428 3.33e-07 55 26 5 180 3 tilS tRNA(Ile)-lysidine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FZ11 3.57e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella suis biovar 1 (strain 1330)
A9WWG9 3.9e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M7J1 3.9e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YIV0 3.93e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REV5 3.93e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella melitensis biotype 2 (strain ATCC 23457)
A5VS49 3.97e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q57BI8 3.97e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella abortus biovar 1 (strain 9-941)
Q2YQH6 3.97e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella abortus (strain 2308)
B2S7D1 3.97e-07 55 35 9 193 3 tilS tRNA(Ile)-lysidine synthase Brucella abortus (strain S19)
Q10441 4.1e-07 55 29 12 231 3 SPAC12B10.08c Probable tRNA(Ile)-lysidine synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WG53 5.08e-07 55 31 8 266 1 tilS tRNA(Ile)-lysidine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG52 5.08e-07 55 31 8 266 3 tilS tRNA(Ile)-lysidine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67152 5.08e-07 55 31 8 266 3 tilS tRNA(Ile)-lysidine synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8EWQ7 5.12e-07 54 20 9 305 3 tilS tRNA(Ile)-lysidine synthase Malacoplasma penetrans (strain HF-2)
Q1XDA4 1.01e-06 54 25 11 231 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Neopyropia yezoensis
B8DWC0 1.53e-06 53 30 5 200 3 tilS tRNA(Ile)-lysidine synthase Bifidobacterium animalis subsp. lactis (strain AD011)
Q7MR31 1.84e-06 53 28 5 184 3 tilS tRNA(Ile)-lysidine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6G5P5 5.14e-06 52 23 8 277 3 tilS tRNA(Ile)-lysidine synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q32RX0 1.32e-05 51 27 5 153 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Staurastrum punctulatum
Q0S8E7 1.43e-05 50 30 3 166 3 tilS tRNA(Ile)-lysidine synthase Rhodococcus jostii (strain RHA1)
P51383 3.46e-05 49 26 9 219 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Porphyra purpurea
A7N0R3 0.00018 47 26 6 176 3 ttcA tRNA-cytidine(32) 2-sulfurtransferase Vibrio campbellii (strain ATCC BAA-1116)
Q5Z2W1 0.000269 46 33 2 104 3 tilS tRNA(Ile)-lysidine synthase Nocardia farcinica (strain IFM 10152)
Q87PG9 0.000339 46 27 6 170 3 ttcA tRNA-cytidine(32) 2-sulfurtransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q85G85 0.000897 44 29 3 126 3 tilS tRNA(Ile)-lysidine synthase, chloroplastic Cyanidioschyzon merolae (strain NIES-3377 / 10D)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_08405
Feature type CDS
Gene tilS
Product tRNA(Ile)-lysidine synthase TilS/MesJ
Location 207335 - 208717 (strand: 1)
Length 1383 (nucleotides) / 460 (amino acids)
In genomic island -

Contig

Accession ZDB_364
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1115
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01171 PP-loop family
PF09179 TilS substrate binding domain
PF11734 TilS substrate C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0037 Translation, ribosomal structure and biogenesis (J) J tRNA(Ile)-lysidine synthase TilS/MesJ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04075 tRNA(Ile)-lysidine synthase [EC:6.3.4.19] - -

Protein Sequence

MDTAFCESLSAVFRRVFASQQAILAGLSGGLDSVVLLHALRQWQTAERPALRLRAVYIHHGLNPLADDWAEHCRTFCDSLSVPFQVCRVQVDPRRKGIEAAARDARYQAFREVIAPDEALVTAQHLDDQSETFFLALKRGSGPAGLSAMPEQMAFGANPLIRPLLSFSRAQLEQYAQYYQLSWVEDDSNQDRRYDRNFLRHAVLPQLNARWPHFAQAVSRSAALCGEQEALLDELLLPELMQLTDADNGLSFIPLLSAGTAKRNGILRRWLKHCGVQMPSQHQLALLWQEVALAKPDAEPGYYLKPVTIRRYQNKLHVTEKTAGLSDYCLPWDLHSALQLPDDAGILRVAETVTTQDVGSVVRPPRPDEQVIVRFGLQGHYHICGRDRGRSAKKLWQECGVAPWLRERTPLLWYNDTLIAAVGVFVTKEGEADEAKLMIMQEKNNPADGVAELFRTVSDQ

Flanking regions ( +/- flanking 50bp)

ATCGCCGCTATGAGCGCCTGATGAGCTACGGCTACTGCTGATAACTAGTTGTGGATACAGCCTTTTGTGAATCACTGTCTGCCGTGTTCCGCCGTGTGTTTGCCTCTCAGCAGGCAATCCTGGCGGGACTGAGCGGCGGGCTTGATTCTGTTGTCCTGCTGCATGCTCTGCGGCAGTGGCAGACCGCTGAGCGCCCGGCATTGCGGTTGCGGGCAGTCTACATTCATCACGGATTAAACCCGCTGGCGGATGACTGGGCAGAACACTGCCGGACATTCTGTGATTCACTCTCTGTTCCGTTTCAGGTGTGCCGCGTGCAGGTTGATCCCCGCAGAAAAGGGATCGAAGCTGCTGCCAGAGACGCACGTTATCAGGCTTTCCGTGAAGTGATAGCTCCGGATGAGGCGCTGGTAACCGCACAGCATCTGGATGATCAGAGCGAAACCTTCTTTCTTGCCTTAAAACGCGGCAGCGGCCCTGCCGGTCTCTCCGCCATGCCGGAACAGATGGCATTCGGTGCCAATCCGCTGATCCGTCCGTTACTCTCCTTCAGCCGTGCTCAGCTCGAACAGTATGCACAATATTATCAGCTTTCCTGGGTCGAGGATGACAGTAATCAGGATCGCCGTTATGACCGCAATTTTCTGCGCCATGCGGTATTACCGCAACTGAATGCCCGCTGGCCGCACTTTGCTCAGGCAGTTTCCCGCAGTGCCGCGCTTTGCGGTGAACAGGAAGCCCTGCTGGATGAACTGCTGCTGCCGGAACTTATGCAGTTAACGGATGCGGATAACGGGTTATCTTTTATCCCGCTGCTCAGCGCCGGGACGGCGAAACGCAACGGCATACTGCGCCGCTGGCTGAAACACTGTGGTGTGCAGATGCCGTCACAGCATCAGTTGGCACTGCTCTGGCAGGAAGTGGCACTGGCGAAACCGGATGCAGAGCCGGGCTATTATCTGAAACCGGTCACCATCCGCCGTTATCAGAATAAACTGCATGTGACAGAAAAAACCGCTGGGTTATCAGACTATTGCCTGCCGTGGGATCTGCACTCTGCGCTGCAACTGCCTGATGATGCAGGTATTTTGCGGGTAGCGGAAACGGTGACTACACAGGATGTGGGTTCGGTGGTACGTCCGCCGCGCCCGGATGAACAGGTGATTGTCCGTTTTGGTTTGCAGGGGCATTATCATATCTGCGGCCGTGATCGCGGGCGATCAGCCAAAAAGTTGTGGCAGGAATGCGGCGTTGCGCCCTGGCTGCGCGAACGCACACCGCTGCTCTGGTATAACGATACGCTGATAGCGGCGGTCGGGGTATTTGTCACGAAAGAGGGAGAAGCGGATGAGGCAAAACTGATGATTATGCAGGAAAAAAACAACCCCGCGGACGGGGTTGCAGAGTTATTCAGGACGGTGAGTGATCAATAACCACTGTTCCCAGTTCGGGATGACTGAAGCTGACAATAGAGTCCAGACGA