Homologs in group_3234

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03895 FBDBKF_03895 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_06640 EHELCC_06640 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_06965 NLDBIP_06965 100.0 Morganella morganii S4 - hypothetical protein
HKOGLL_04430 HKOGLL_04430 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3234

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3234

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_06500
Feature type CDS
Gene -
Product hypothetical protein
Location 30571 - 30765 (strand: 1)
Length 195 (nucleotides) / 64 (amino acids)
In genomic island -

Contig

Accession ZDB_363
Length 233386 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3234
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTELRSSLKSTEGDNRIALSSGLFLRNASYNLPADGEITRHQGISPFFQEKFNEGIYISGIVFF

Flanking regions ( +/- flanking 50bp)

TGATTGCCACTGCCAATCCTCGGGTCATCTGAGACGGGAGCCTACGGGCGATGACAGAACTCCGTTCGTCCTTGAAATCGACGGAGGGTGATAACAGAATAGCGTTATCATCAGGATTATTTTTACGCAACGCTTCATATAACCTGCCCGCTGACGGGGAAATCACCCGTCATCAGGGAATTTCTCCGTTTTTTCAGGAGAAATTCAATGAAGGTATCTACATTTCCGGAATCGTCTTTTTTTGACGATCTGCACTCTCTCACGCAACTGCATCACCTCTCAGGTGAGCTCGACA