Homologs in group_137

Help

9 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00200 FBDBKF_00200 100.0 Morganella morganii S1 - hypothetical protein
FBDBKF_11325 FBDBKF_11325 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_01345 EHELCC_01345 100.0 Morganella morganii S2 - hypothetical protein
EHELCC_17890 EHELCC_17890 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_02115 NLDBIP_02115 100.0 Morganella morganii S4 - hypothetical protein
NLDBIP_05220 NLDBIP_05220 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_02100 LHKJJB_02100 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_03415 HKOGLL_03415 100.0 Morganella morganii S5 - hypothetical protein
HKOGLL_15480 HKOGLL_15480 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_137

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_137

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_03630
Feature type CDS
Gene -
Product hypothetical protein
Location 10803 - 10898 (strand: -1)
Length 96 (nucleotides) / 31 (amino acids)
In genomic island -

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_137
Orthogroup size 10
N. genomes 5

Actions

Genomic region

Protein Sequence

MIKRILGYLSNPFTLSWVIFVIALGIYEYWW

Flanking regions ( +/- flanking 50bp)

CAACGAATGTCCGCATCTGGAAGTAGTCGAGAAGATGAAAGGAGATGGTGATGATTAAGCGCATCCTGGGATATCTGAGCAATCCGTTCACTCTGAGCTGGGTAATATTTGTTATTGCACTCGGCATCTATGAATACTGGTGGTGAGTATGGCAAAGCAATCGCGGCGAAAGTGCCTGATATGCCGGGCATGGTTT