Homologs in group_2579

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02840 FBDBKF_02840 100.0 Morganella morganii S1 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
EHELCC_03310 EHELCC_03310 100.0 Morganella morganii S2 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
NLDBIP_00150 NLDBIP_00150 100.0 Morganella morganii S4 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
HKOGLL_01925 HKOGLL_01925 100.0 Morganella morganii S5 fepB ABC-type Fe3+-hydroxamate transport system, periplasmic component
F4V73_RS05280 F4V73_RS05280 84.2 Morganella psychrotolerans - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_2579

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2579

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34805 1.37e-07 55 26 11 275 3 yvrC Uncharacterized ABC transporter substrate-binding lipoprotein YvrC Bacillus subtilis (strain 168)
Q7N842 3.59e-07 54 25 10 214 3 btuF Vitamin B12-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66EE7 9.45e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K552 9.45e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM05 9.45e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPX1 9.54e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pestis (strain Pestoides F)
Q1CLU2 9.54e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E1 9.54e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM3 9.54e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pestis
Q1C3X6 9.54e-07 53 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
B1JK18 1.17e-06 52 23 9 222 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
C0SP94 0.000631 44 26 11 291 1 yhfQ Putative ABC transporter substrate-binding lipoprotein YhfQ Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_01885
Feature type CDS
Gene fepB
Product ABC-type Fe3+-hydroxamate transport system, periplasmic component
Location 363063 - 364031 (strand: -1)
Length 969 (nucleotides) / 322 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2579
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01497 Periplasmic binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0614 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-hydroxamate transport system, periplasmic component

Protein Sequence

MKKLLLGTLVISALFSVTATAENKKAQAYVPVEFSAKLDGNEYHFKPETSPQRIVSLSQITTEMLLALDLGDRMVGTAFLEEPIYPPVKAAYDKIPVLAEKWPSYEVFMSVKPDFATGWANSFSKLALEANKIVPEGVAVYVPESMTSPKADVNTYFNDMLKFGEIFGVQETAEKYVAAEKEKLNTVISQIQAYPEKTAFIFDSQDGKPYTFFDGYTSEMLKLISVKNIFAGKNTGKTWAVGNWEDVIMSDPEVIIIPVYKGFRNDDDYDQKVAFIESMPEMQGVKAVKNKNYIKVNLSELVPGPRSIDILPVLAKEIHEKP

Flanking regions ( +/- flanking 50bp)

ACCGGTAGAAGACCGTGTTGCTATATTTTTATAATCCGGATGAGGAAATTATGAAAAAATTATTATTAGGTACCCTGGTTATCTCTGCATTGTTTTCCGTGACAGCCACTGCGGAAAATAAAAAAGCACAGGCTTATGTTCCTGTTGAATTCAGTGCAAAACTGGATGGCAACGAATATCACTTTAAACCGGAAACATCCCCGCAGCGTATTGTTTCTCTCAGCCAGATCACCACCGAAATGCTGCTGGCACTGGATTTGGGGGACCGTATGGTCGGTACCGCTTTTCTGGAAGAGCCGATTTATCCGCCGGTAAAAGCAGCATATGACAAAATTCCCGTATTGGCAGAAAAATGGCCGTCTTACGAAGTCTTTATGTCTGTCAAACCCGATTTCGCCACCGGCTGGGCAAACTCATTCTCAAAACTGGCATTGGAAGCCAATAAAATTGTGCCGGAAGGGGTTGCCGTTTATGTGCCGGAATCCATGACATCACCGAAAGCAGATGTGAATACCTATTTTAACGACATGCTGAAATTTGGTGAGATCTTCGGTGTACAAGAGACCGCTGAAAAATACGTGGCGGCAGAAAAAGAAAAACTGAATACCGTTATCAGCCAGATTCAGGCGTATCCGGAAAAAACTGCCTTTATTTTTGATTCTCAGGACGGTAAACCCTATACCTTCTTTGATGGTTATACCTCAGAGATGCTGAAACTGATTTCTGTTAAGAATATTTTTGCCGGCAAAAATACCGGAAAAACCTGGGCGGTCGGTAACTGGGAAGATGTGATTATGTCTGATCCGGAAGTGATCATTATTCCTGTCTATAAAGGCTTCCGTAATGATGATGATTATGACCAGAAAGTGGCATTTATTGAGTCCATGCCGGAAATGCAGGGTGTAAAAGCCGTGAAAAATAAAAATTATATTAAAGTGAATCTGTCCGAATTAGTGCCGGGACCGCGCTCGATTGATATTTTGCCGGTACTGGCAAAAGAAATTCACGAAAAACCGTAACGTTCTCTGAATTCCGCACCGGGTTTCCGGTGCGGATAGTTACATAATCA