Homologs in group_3664

Help

3 homologs were identified in 3 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20135 FBDBKF_20135 100.0 Morganella morganii S1 - Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase
NLDBIP_19610 NLDBIP_19610 100.0 Morganella morganii S4 - Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase
LHKJJB_19575 LHKJJB_19575 100.0 Morganella morganii S3 - Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase

Distribution of the homologs in the orthogroup group_3664

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3664

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2FLK4 3.66e-91 283 69 2 189 3 Smlt4431 Glycosyl hydrolase family 109 protein Stenotrophomonas maltophilia (strain K279a)
A4Q8G1 1.54e-72 235 56 1 181 3 nagA Alpha-N-acetylgalactosaminidase Tannerella forsythia
A6LB54 2.28e-72 234 57 1 181 3 BDI_1155 Glycosyl hydrolase family 109 protein Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A4Q8F7 5.89e-69 225 52 1 194 1 nagA Alpha-N-acetylgalactosaminidase Elizabethkingia meningoseptica
A0KYQ9 1.75e-36 140 41 3 174 3 Shewana3_2701 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain ANA-3)
Q0HTG8 1.8e-36 140 41 3 174 3 Shewmr7_2602 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain MR-7)
Q0HH61 3.16e-36 139 41 3 174 3 Shewmr4_2535 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain MR-4)
A8H2K3 1.12e-35 137 38 4 180 3 Spea_1465 Glycosyl hydrolase family 109 protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1S4U5 4.58e-35 136 39 3 174 3 Sama_1194 Glycosyl hydrolase family 109 protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8ECL7 2.89e-34 134 38 3 175 3 nagA Alpha-N-acetylgalactosaminidase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1KNF7 3.22e-34 134 38 4 182 3 Swoo_1749 Glycosyl hydrolase family 109 protein Shewanella woodyi (strain ATCC 51908 / MS32)
A1RI61 3.27e-34 134 38 3 175 3 Sputw3181_1518 Glycosyl hydrolase family 109 protein Shewanella sp. (strain W3-18-1)
A3D6B7 4.61e-34 133 37 3 175 3 Sbal_2793 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
A4Y8C8 4.7e-34 133 38 3 175 3 Sputcn32_2490 Glycosyl hydrolase family 109 protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WQ58 5.1e-34 133 37 3 175 3 Shew185_2813 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS185)
A9KUT1 5.21e-34 133 37 3 175 3 Sbal195_2933 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS195)
Q0HKG4 1.07e-33 132 38 3 175 3 Shewmr4_1375 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain MR-4)
A0KV43 2.02e-33 131 38 3 175 3 Shewana3_1428 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain ANA-3)
Q0HWR6 2.06e-33 131 38 3 175 3 Shewmr7_1440 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain MR-7)
Q01S58 3.01e-32 128 38 2 175 3 Acid_6590 Glycosyl hydrolase family 109 protein Solibacter usitatus (strain Ellin6076)
B2UQL7 1.44e-31 126 37 3 187 1 Amuc_0920 Glycosyl hydrolase family 109 protein 2 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B2UL75 3.24e-30 123 38 3 187 3 Amuc_0017 Glycosyl hydrolase family 109 protein 1 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q9RK81 4.13e-30 122 39 3 182 3 SCO0529 Glycosyl hydrolase family 109 protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4FN60 1.49e-24 107 36 2 176 3 SACE_6314 Glycosyl hydrolase family 109 protein Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q89ZW9 1.81e-23 103 34 2 175 3 BT_4252 Glycosyl hydrolase family 109 protein 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64XS1 2.02e-23 103 34 2 172 3 BF0955 Glycosyl hydrolase family 109 protein 2 Bacteroides fragilis (strain YCH46)
Q5LGW9 2.02e-23 103 34 2 172 3 BF0874 Alpha-N-acetylgalactosaminidase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B1W5J7 1.41e-22 101 32 3 179 3 SGR_6325 Glycosyl hydrolase family 109 protein Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q50EA3 3.14e-22 100 33 3 178 3 None Glycosyl hydrolase family 109 protein Streptomyces filamentosus
A8AMR4 8.61e-22 99 43 4 138 3 dsbD Thiol:disulfide interchange protein DsbD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P58162 2.01e-21 98 41 4 136 1 dsbD Thiol:disulfide interchange protein DsbD Escherichia coli O157:H7
Q50HM6 2.39e-21 98 32 3 183 3 None Glycosyl hydrolase family 109 protein Streptomyces niveus
Q8ZKC3 2.72e-21 98 43 5 139 3 dsbD Thiol:disulfide interchange protein DsbD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57GQ5 3.1e-21 98 43 5 139 3 dsbD Thiol:disulfide interchange protein DsbD Salmonella choleraesuis (strain SC-B67)
Q5PIQ0 3.22e-21 97 43 5 139 3 dsbD Thiol:disulfide interchange protein DsbD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z1A8 4.51e-21 97 42 5 139 3 dsbD Thiol:disulfide interchange protein DsbD Salmonella typhi
Q3YUK4 7.17e-21 97 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Shigella sonnei (strain Ss046)
Q0SXE3 8.26e-21 96 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Shigella flexneri serotype 5b (strain 8401)
Q1R3C4 8.98e-21 96 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Escherichia coli (strain UTI89 / UPEC)
Q8CVH5 8.98e-21 96 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9Q5 8.98e-21 96 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q328D2 9.59e-21 96 41 4 136 1 dsbD Thiol:disulfide interchange protein DsbD Shigella dysenteriae serotype 1 (strain Sd197)
P36655 9.68e-21 96 41 4 136 1 dsbD Thiol:disulfide interchange protein DsbD Escherichia coli (strain K12)
A6KY05 1.96e-20 94 32 2 174 3 BVU_0611 Glycosyl hydrolase family 109 protein 2 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q31T72 2.29e-20 95 41 4 136 3 dsbD Thiol:disulfide interchange protein DsbD Shigella boydii serotype 4 (strain Sb227)
A6TH46 1.56e-19 93 39 5 141 3 dsbD Thiol:disulfide interchange protein DsbD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5QVU3 1.66e-19 92 37 5 150 3 dsbD Thiol:disulfide interchange protein DsbD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3N207 2e-19 92 38 4 142 3 dsbD Thiol:disulfide interchange protein DsbD Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7MZX2 3.35e-19 92 40 3 112 3 dsbD Thiol:disulfide interchange protein DsbD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8XV41 4.43e-19 91 47 6 129 3 dsbD Thiol:disulfide interchange protein DsbD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6KWM1 5.73e-19 91 31 4 171 3 BVU_0105 Glycosyl hydrolase family 109 protein 4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q66FE1 1.44e-18 90 39 3 109 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRR6 1.51e-18 90 39 3 109 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia pestis (strain Pestoides F)
Q1CEC8 1.51e-18 90 39 3 109 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZIY9 1.51e-18 90 39 3 109 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia pestis
Q1C0X4 1.51e-18 90 39 3 109 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia pestis bv. Antiqua (strain Antiqua)
Q9I104 2.06e-18 89 40 3 123 3 dsbD2 Thiol:disulfide interchange protein DsbD 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6L1Z2 7.86e-18 87 30 5 174 3 BVU_2041 Glycosyl hydrolase family 109 protein 5 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6KX96 9.65e-18 87 30 3 166 3 BVU_0340 Glycosyl hydrolase family 109 protein 1 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q7MGV6 1.54e-17 87 40 4 115 3 dsbD Thiol:disulfide interchange protein DsbD Vibrio vulnificus (strain YJ016)
A7MMC7 2.44e-17 86 40 3 115 3 dsbD Thiol:disulfide interchange protein DsbD Cronobacter sakazakii (strain ATCC BAA-894)
A1JIN7 2.66e-17 86 37 3 112 3 dsbD Thiol:disulfide interchange protein DsbD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MWF4 2.69e-17 85 30 4 169 3 PG_0664 Glycosyl hydrolase family 109 protein Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9KJZ3 2.79e-17 86 36 4 141 3 dsbD Thiol:disulfide interchange protein DsbD Pseudomonas sp. (strain JR1 / K1)
Q6D9J6 4.38e-17 85 40 3 112 3 dsbD Thiol:disulfide interchange protein DsbD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8DCZ0 4.77e-17 85 39 4 112 3 dsbD Thiol:disulfide interchange protein DsbD Vibrio vulnificus (strain CMCP6)
Q89ZX8 4.83e-17 85 31 4 170 3 BT_4243 Glycosyl hydrolase family 109 protein 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q9HUW5 7.2e-17 85 41 3 112 3 dsbD1 Thiol:disulfide interchange protein DsbD 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C863 1.25e-16 84 31 4 173 3 BF0931 Glycosyl hydrolase family 109 protein 1 Bacteroides fragilis (strain YCH46)
Q5LGZ0 1.25e-16 84 31 4 173 1 BF0853 Glycosyl hydrolase family 109 protein 1 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q9KNN1 2.59e-16 83 38 3 111 3 dsbD Thiol:disulfide interchange protein DsbD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4K909 1.58e-15 80 41 4 115 3 dsbD Thiol:disulfide interchange protein DsbD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6KYY1 1.75e-15 80 27 3 181 3 BVU_0950 Glycosyl hydrolase family 109 protein 3 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q87KW0 5.44e-15 79 36 4 112 3 dsbD Thiol:disulfide interchange protein DsbD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CP40 6.33e-15 79 37 7 120 3 dsbD Thiol:disulfide interchange protein DsbD Pasteurella multocida (strain Pm70)
Q9XDB2 1.77e-14 77 37 2 96 3 dsbD Thiol:disulfide interchange protein DsbD Tatumella citrea
Q2NW99 3.83e-14 77 33 5 156 3 dsbD Thiol:disulfide interchange protein DsbD Sodalis glossinidius (strain morsitans)
Q9JYM0 5e-14 76 35 2 131 1 dsbD Thiol:disulfide interchange protein DsbD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JTL9 5e-14 76 35 2 131 3 dsbD Thiol:disulfide interchange protein DsbD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q487R3 3.42e-13 73 33 4 124 3 dsbD Thiol:disulfide interchange protein DsbD Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VMZ4 6.88e-13 73 35 5 111 3 dsbD Thiol:disulfide interchange protein DsbD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q15ZS2 2.67e-11 68 34 4 113 3 dsbD Thiol:disulfide interchange protein DsbD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q4QM23 1.13e-10 66 33 5 114 3 dsbD Thiol:disulfide interchange protein DsbD Haemophilus influenzae (strain 86-028NP)
A5UI29 1.22e-10 66 33 5 114 3 dsbD Thiol:disulfide interchange protein DsbD Haemophilus influenzae (strain PittGG)
P44919 2.18e-10 65 32 5 114 3 dsbD Thiol:disulfide interchange protein DsbD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDI9 3.18e-10 64 32 5 114 3 dsbD Thiol:disulfide interchange protein DsbD Haemophilus influenzae (strain PittEE)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19490
Feature type CDS
Gene -
Product Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase
Location 6394 - 7425 (strand: -1)
Length 1032 (nucleotides) / 343 (amino acids)

Contig

Accession ZDB_716
Length 7614 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3664
Orthogroup size 4
N. genomes 4

Actions

Genomic region

Domains

PF11412 Thiol:disulfide interchange protein DsbD, N-terminal
PF21252 Glycosyl hydrolase 109, C-terminal domain

Protein Sequence

MTASTIRLRRWLAGLALLLALPATSAVAQDFELPPVDEVFVLSAQATAPDRIEVRWRIADGYYLYRHRTSVKADAAFTGATMALPKGKAYRDEFFGDVETYRKELLGTLTGTPAAGASATTLTVKYQGCADAGVCYPPQTRTLKVALPGEAGAGGFGCKARGLHDYVVKNGSADHPNAEVKFALGDVVNTMIGCTNGETIMLCHDTSLPRPYSLGFRVQGTEGLWMDVNKSIYLEGKSPQPHRWEPAEGWFAKYDHPLWKRYADLAAGAGHGGMDWFVIHAFVEALKAKAPMPIDIYDALAWSAITPLSEQSIAEGNRTLDFPDFTRGQWRTRKPIFALNDAY

Flanking regions ( +/- flanking 50bp)

CGAATACCTGCAATGGCTGGCCGCCGAGAGCCGACCGGTAAACTGAGCCAATGACCGCATCCACGATCCGCCTGCGCCGCTGGCTGGCCGGGCTCGCCCTGCTGCTTGCGCTGCCCGCGACCTCGGCCGTCGCCCAGGACTTCGAACTGCCGCCGGTCGACGAGGTCTTCGTCCTGTCCGCGCAGGCCACCGCGCCGGACCGCATCGAGGTGCGCTGGCGGATCGCCGACGGCTATTACCTGTACCGGCACCGCACCTCGGTCAAGGCCGATGCCGCCTTCACCGGCGCGACCATGGCGCTGCCGAAGGGCAAGGCCTACCGCGACGAATTCTTCGGCGACGTCGAAACCTACCGCAAGGAATTGCTCGGCACCCTCACCGGCACGCCCGCGGCCGGCGCGAGCGCGACCACCCTGACCGTGAAGTACCAGGGCTGCGCCGATGCCGGCGTGTGCTACCCGCCGCAGACCCGCACCCTGAAGGTCGCGTTGCCGGGCGAAGCGGGCGCTGGCGGCTTCGGCTGTAAGGCGCGCGGGCTGCATGATTATGTCGTCAAGAACGGCTCTGCCGATCATCCCAACGCCGAGGTGAAATTCGCACTGGGTGATGTGGTCAACACCATGATCGGCTGCACTAATGGTGAAACGATCATGCTGTGCCACGACACCTCGCTGCCGCGCCCCTATTCTCTCGGCTTTCGGGTGCAAGGCACCGAGGGGCTGTGGATGGACGTCAACAAGTCGATCTATCTGGAGGGCAAGAGCCCACAGCCGCACCGCTGGGAGCCTGCCGAGGGCTGGTTTGCGAAATACGATCACCCGCTATGGAAACGCTACGCCGATCTGGCGGCAGGGGCCGGGCATGGCGGGATGGACTGGTTCGTGATCCACGCTTTTGTCGAGGCGCTGAAGGCCAAGGCCCCGATGCCAATCGACATTTACGACGCGCTGGCCTGGAGCGCGATCACGCCTCTGTCGGAACAATCGATTGCTGAGGGCAATCGCACGTTAGATTTTCCCGACTTCACCCGAGGGCAGTGGCGCACCCGCAAGCCGATCTTTGCGCTGAACGACGCCTATTGATCGACGCGATTTAGGCCAAGCGCACCGCAAAGGCGAAATTGGTAATCTTG