Homologs in group_3614

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20130 FBDBKF_20130 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_19335 EHELCC_19335 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_19465 NLDBIP_19465 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_19485 LHKJJB_19485 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain

Distribution of the homologs in the orthogroup group_3614

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3614

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8TZX4 8.88e-07 48 38 0 54 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P15017 1.21e-06 45 35 0 64 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q97QZ2 2.05e-06 46 36 0 57 1 pezA Antitoxin PezA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9ZD50 1.08e-05 43 31 0 67 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
P55681 1.1e-05 44 29 0 74 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P96631 1.47e-05 43 30 0 60 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)
P0C5S2 2.62e-05 43 32 0 67 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 2.62e-05 43 32 0 67 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
Q9V1R0 3.1e-05 43 35 0 53 3 PYRAB03670 Putative HTH-type transcriptional regulatory protein PYRAB03670 Pyrococcus abyssi (strain GE5 / Orsay)
Q92HV3 4.54e-05 42 29 0 67 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q5JF28 4.87e-05 43 37 0 53 3 TK0539 Putative HTH-type transcriptional regulatory protein TK0539 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O31943 7.99e-05 41 27 0 68 4 yonR SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YonR Bacillus subtilis (strain 168)
P9WMH9 0.000345 40 33 0 65 1 Rv0474 Uncharacterized HTH-type transcriptional regulator Rv0474 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMH8 0.000345 40 33 0 65 4 MT0491 Uncharacterized HTH-type transcriptional regulator MT0491 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P55409 0.000364 38 31 1 73 4 NGR_a04070 Uncharacterized HTH-type transcriptional regulator y4dJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8ZWT6 0.000377 40 37 0 53 3 PAE1627 Putative HTH-type transcriptional regulatory protein PAE1627 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
O59472 0.001 39 32 0 53 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19345
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 405 - 680 (strand: -1)
Length 276 (nucleotides) / 91 (amino acids)

Contig

Accession ZDB_714
Length 12946 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3614
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MKDINFIVGQNIRDLRHRNGLTTKMLAKMLGVSQQQLSRYERGVNKIDVSVVFKIINIFHVSYEFLFPETQNDYTESVKSSFVYMEPLAIG

Flanking regions ( +/- flanking 50bp)

GTCAGCATATTATGCTTTACCTTTAATATATGTTTATCAGGAGGTTCATAATGAAAGATATTAATTTTATTGTAGGGCAGAATATCCGCGACTTAAGACACCGTAATGGCTTGACTACAAAGATGTTAGCTAAAATGCTGGGGGTCTCACAGCAGCAGTTGTCAAGGTATGAACGGGGTGTTAATAAAATAGATGTCAGTGTTGTATTTAAGATAATAAATATATTTCATGTGTCTTATGAATTTCTGTTTCCTGAAACTCAGAATGATTATACTGAATCAGTAAAAAGCTCCTTTGTATATATGGAGCCTTTAGCAATCGGGTAATACAAAAAAATACAATCATAAATGTTATTCATTACCATATAAACAATGAA