Homologs in group_3368

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11520 FBDBKF_11520 100.0 Morganella morganii S1 - DNA polymerase II
EHELCC_17440 EHELCC_17440 100.0 Morganella morganii S2 - DNA polymerase II
NLDBIP_18650 NLDBIP_18650 100.0 Morganella morganii S4 - DNA polymerase II
LHKJJB_17880 LHKJJB_17880 100.0 Morganella morganii S3 - DNA polymerase II

Distribution of the homologs in the orthogroup group_3368

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3368

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABT1 2.5e-16 69 52 0 59 3 holE DNA polymerase III subunit theta Shigella flexneri
P0ABS8 2.5e-16 69 52 0 59 1 holE DNA polymerase III subunit theta Escherichia coli (strain K12)
P0ABS9 2.5e-16 69 52 0 59 3 holE DNA polymerase III subunit theta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT0 2.5e-16 69 52 0 59 3 holE DNA polymerase III subunit theta Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18770
Feature type CDS
Gene -
Product DNA polymerase II
Location 23423 - 23647 (strand: 1)
Length 225 (nucleotides) / 74 (amino acids)
In genomic island -

Contig

Accession ZDB_707
Length 24230 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3368
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF06440 DNA polymerase III, theta subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02345 DNA polymerase III subunit theta [EC:2.7.7.7] DNA replication
Mismatch repair
Homologous recombination
-

Protein Sequence

MHNIANLPQNEKDKINADLAASGIAYKERLGLPYDLYETENQQPEHLRQYFRERLEHYREIGKRFPRGFEYEKN

Flanking regions ( +/- flanking 50bp)

TCCTCTCCCCCTGCTATACTCCCATCATCACCCACCACTCCGAATCCAACATGCACAATATCGCCAACCTGCCACAAAACGAAAAAGACAAAATTAATGCCGATTTAGCCGCATCCGGTATCGCGTACAAAGAAAGACTCGGACTGCCGTATGATCTGTACGAAACAGAAAACCAGCAGCCCGAGCATTTACGCCAGTACTTCAGAGAGAGGCTGGAGCACTACAGGGAGATCGGGAAAAGGTTTCCGCGCGGGTTCGAGTATGAGAAGAACTAATTATTTTCCTGCGCTTCACGTTCTGCCTGCTCACGCTCCATCTGTTCAGC