Homologs in group_2430

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19235 FBDBKF_19235 100.0 Morganella morganii S1 rplW 50S ribosomal protein L23
EHELCC_18980 EHELCC_18980 100.0 Morganella morganii S2 rplW 50S ribosomal protein L23
NLDBIP_18995 NLDBIP_18995 100.0 Morganella morganii S4 rplW 50S ribosomal protein L23
LHKJJB_18850 LHKJJB_18850 100.0 Morganella morganii S3 rplW 50S ribosomal protein L23
F4V73_RS18930 F4V73_RS18930 98.0 Morganella psychrotolerans rplW 50S ribosomal protein L23
PMI_RS16160 PMI_RS16160 92.0 Proteus mirabilis HI4320 rplW 50S ribosomal protein L23

Distribution of the homologs in the orthogroup group_2430

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2430

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CPL3 8.82e-63 188 94 0 100 3 rplW Large ribosomal subunit protein uL23 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGM6 8.82e-63 188 94 0 100 3 rplW Large ribosomal subunit protein uL23 Salmonella typhi
Q5PIV4 8.82e-63 188 94 0 100 3 rplW Large ribosomal subunit protein uL23 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57J34 8.82e-63 188 94 0 100 3 rplW Large ribosomal subunit protein uL23 Salmonella choleraesuis (strain SC-B67)
Q7MYF3 2.45e-62 187 91 0 100 3 rplW Large ribosomal subunit protein uL23 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YWU1 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Shigella sonnei (strain Ss046)
P0ADZ3 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Shigella flexneri
Q31VV8 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Shigella boydii serotype 4 (strain Sb227)
Q1R606 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Escherichia coli (strain UTI89 / UPEC)
P0ADZ0 2.5e-62 187 93 0 100 1 rplW Large ribosomal subunit protein uL23 Escherichia coli (strain K12)
P0ADZ1 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE3 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0ADZ2 2.5e-62 187 93 0 100 3 rplW Large ribosomal subunit protein uL23 Escherichia coli O157:H7
B4F1I6 3.37e-62 187 92 0 100 3 rplW Large ribosomal subunit protein uL23 Proteus mirabilis (strain HI4320)
Q32B33 4.16e-61 184 92 0 100 3 rplW Large ribosomal subunit protein uL23 Shigella dysenteriae serotype 1 (strain Sd197)
P0C2N0 6.24e-61 183 91 0 100 1 rplW Large ribosomal subunit protein uL23 Yersinia enterocolitica
A1JS44 6.24e-61 183 91 0 100 3 rplW Large ribosomal subunit protein uL23 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6CZX2 6.97e-61 183 91 0 100 3 rplW Large ribosomal subunit protein uL23 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P69964 1.49e-60 182 90 0 100 3 rplW Large ribosomal subunit protein uL23 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CCU6 1.49e-60 182 90 0 100 3 rplW Large ribosomal subunit protein uL23 Yersinia pestis bv. Antiqua (strain Nepal516)
P69963 1.49e-60 182 90 0 100 3 rplW Large ribosomal subunit protein uL23 Yersinia pestis
Q1C2U9 1.49e-60 182 90 0 100 3 rplW Large ribosomal subunit protein uL23 Yersinia pestis bv. Antiqua (strain Antiqua)
Q2NQM4 5.62e-59 179 89 0 100 3 rplW Large ribosomal subunit protein uL23 Sodalis glossinidius (strain morsitans)
C5BGM3 1.65e-58 177 88 0 100 3 rplW Large ribosomal subunit protein uL23 Edwardsiella ictaluri (strain 93-146)
C3LRQ6 4.95e-52 161 80 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNY6 4.95e-52 161 80 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F547 4.95e-52 161 80 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VLF5 1.77e-50 157 79 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio atlanticus (strain LGP32)
Q87T11 2.46e-50 157 79 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWI5 2.46e-50 157 79 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio campbellii (strain ATCC BAA-1116)
Q3IF23 6.53e-50 155 77 0 100 3 rplW Large ribosomal subunit protein uL23 Pseudoalteromonas translucida (strain TAC 125)
Q487Z5 6.9e-50 155 78 0 98 3 rplW Large ribosomal subunit protein uL23 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7MPI6 8.49e-50 155 78 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio vulnificus (strain YJ016)
Q8DE41 8.49e-50 155 78 0 100 3 rplW Large ribosomal subunit protein uL23 Vibrio vulnificus (strain CMCP6)
C4L7T2 1.06e-49 155 78 0 99 3 rplW Large ribosomal subunit protein uL23 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q9CL34 1.35e-48 152 75 0 100 3 rplW Large ribosomal subunit protein uL23 Pasteurella multocida (strain Pm70)
A4ST04 1.24e-46 147 72 0 100 3 rplW Large ribosomal subunit protein uL23 Aeromonas salmonicida (strain A449)
A0KF23 1.31e-46 147 73 0 100 3 rplW Large ribosomal subunit protein uL23 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1S220 1.49e-46 147 72 0 98 3 rplW Large ribosomal subunit protein uL23 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12SV7 4.93e-46 146 72 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0I161 5.73e-46 145 72 0 99 3 rplW Large ribosomal subunit protein uL23 Histophilus somni (strain 129Pt)
Q7VKD4 8.32e-46 145 71 0 99 3 rplW Large ribosomal subunit protein uL23 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8CND5 9.84e-46 145 70 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella piezotolerans (strain WP3 / JCM 13877)
P44361 1.95e-45 144 70 0 99 3 rplW Large ribosomal subunit protein uL23 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT2 1.95e-45 144 70 0 99 3 rplW Large ribosomal subunit protein uL23 Haemophilus influenzae (strain PittGG)
Q4QMC0 1.95e-45 144 70 0 99 3 rplW Large ribosomal subunit protein uL23 Haemophilus influenzae (strain 86-028NP)
Q0I0A3 2.95e-45 144 72 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella sp. (strain MR-7)
Q0HNT5 2.95e-45 144 72 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella sp. (strain MR-4)
B6EPS7 4.14e-45 144 73 0 100 3 rplW Large ribosomal subunit protein uL23 Aliivibrio salmonicida (strain LFI1238)
Q8EK66 4.52e-45 143 72 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5QXX9 5.38e-45 143 70 0 100 3 rplW Large ribosomal subunit protein uL23 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6LVB4 6.93e-45 143 71 0 100 3 rplW Large ribosomal subunit protein uL23 Photobacterium profundum (strain SS9)
B5FG11 1.05e-44 142 74 0 100 3 rplW Large ribosomal subunit protein uL23 Aliivibrio fischeri (strain MJ11)
Q5E8B3 1.05e-44 142 74 0 100 3 rplW Large ribosomal subunit protein uL23 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8GYX8 1.78e-44 142 69 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TM10 2.92e-44 141 69 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella halifaxensis (strain HAW-EB4)
P55839 4.1e-44 141 70 0 98 3 rplW Large ribosomal subunit protein uL23 Aggregatibacter actinomycetemcomitans
Q65QV7 1.81e-43 139 69 0 99 3 rplW Large ribosomal subunit protein uL23 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A3Q984 4.84e-43 138 67 0 98 3 rplW Large ribosomal subunit protein uL23 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q089Q2 9.43e-43 137 69 0 100 3 rplW Large ribosomal subunit protein uL23 Shewanella frigidimarina (strain NCIMB 400)
Q15YN7 2.22e-42 137 70 0 97 3 rplW Large ribosomal subunit protein uL23 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1T0E0 1.08e-40 132 68 0 97 3 rplW Large ribosomal subunit protein uL23 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1LTD6 2.17e-40 132 63 0 100 3 rplW Large ribosomal subunit protein uL23 Baumannia cicadellinicola subsp. Homalodisca coagulata
A8G1E6 7.11e-40 130 63 0 98 3 rplW Large ribosomal subunit protein uL23 Shewanella sediminis (strain HAW-EB3)
B1KMY1 1.03e-39 130 64 0 98 3 rplW Large ribosomal subunit protein uL23 Shewanella woodyi (strain ATCC 51908 / MS32)
Q8K952 1.98e-38 127 58 0 100 3 rplW Large ribosomal subunit protein uL23 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5UDU5 5.89e-37 123 66 0 90 3 rplW Large ribosomal subunit protein uL23 Haemophilus influenzae (strain PittEE)
Q0VSK1 2.25e-36 121 61 0 97 3 rplW Large ribosomal subunit protein uL23 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0ABH3 5.32e-36 120 60 0 99 3 rplW Large ribosomal subunit protein uL23 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q7NQF4 2.85e-35 119 62 0 94 3 rplW Large ribosomal subunit protein uL23 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4VHN2 1.14e-34 117 58 0 99 3 rplW Large ribosomal subunit protein uL23 Stutzerimonas stutzeri (strain A1501)
A1WVC0 1.96e-34 116 58 0 97 3 rplW Large ribosomal subunit protein uL23 Halorhodospira halophila (strain DSM 244 / SL1)
Q493K6 1.5e-33 114 53 0 100 3 rplW Large ribosomal subunit protein uL23 Blochmanniella pennsylvanica (strain BPEN)
C5BQ63 3.28e-33 113 61 0 97 3 rplW Large ribosomal subunit protein uL23 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q89A70 6.08e-33 113 54 0 100 3 rplW Large ribosomal subunit protein uL23 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3SLP7 9.08e-33 112 57 0 97 3 rplW Large ribosomal subunit protein uL23 Thiobacillus denitrificans (strain ATCC 25259)
B8D847 1.22e-32 112 60 0 100 3 rplW Large ribosomal subunit protein uL23 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57589 1.22e-32 112 60 0 100 3 rplW Large ribosomal subunit protein uL23 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U5 1.22e-32 112 60 0 100 3 rplW Large ribosomal subunit protein uL23 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C1DKL5 1.23e-32 112 57 0 99 3 rplW Large ribosomal subunit protein uL23 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9HWD7 2.32e-32 111 56 0 99 1 rplW Large ribosomal subunit protein uL23 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T78 2.32e-32 111 56 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V646 2.32e-32 111 56 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas aeruginosa (strain LESB58)
A6UZJ0 2.32e-32 111 56 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas aeruginosa (strain PA7)
B1JDW2 4.88e-32 110 58 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas putida (strain W619)
Q88QN3 4.88e-32 110 58 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK69 4.88e-32 110 58 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas putida (strain GB-1)
A5VXP9 4.88e-32 110 58 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFW4 4.88e-32 110 58 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas entomophila (strain L48)
Q4ZMP6 1.35e-31 109 57 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas syringae pv. syringae (strain B728a)
Q889W9 1.35e-31 109 57 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5Z0 1.35e-31 109 57 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas fluorescens (strain Pf0-1)
C3K2X4 1.35e-31 109 57 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas fluorescens (strain SBW25)
Q4K535 1.35e-31 109 57 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48D38 3.83e-31 108 56 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1KB25 4.67e-31 108 55 0 97 3 rplW Large ribosomal subunit protein uL23 Azoarcus sp. (strain BH72)
B8GV56 6.57e-31 107 58 0 96 3 rplW Large ribosomal subunit protein uL23 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1ALU3 1.21e-30 107 57 0 89 3 rplW Large ribosomal subunit protein uL23 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A4XZ88 1.41e-30 107 55 0 99 3 rplW Large ribosomal subunit protein uL23 Pseudomonas mendocina (strain ymp)
Q47JA1 2.22e-30 106 55 0 98 3 rplW Large ribosomal subunit protein uL23 Dechloromonas aromatica (strain RCB)
Q3J8R6 2.42e-30 106 57 0 94 3 rplW Large ribosomal subunit protein uL23 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1H4N5 4.02e-30 105 53 0 95 3 rplW Large ribosomal subunit protein uL23 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5P330 7.13e-30 105 54 0 95 3 rplW Large ribosomal subunit protein uL23 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5FTY5 1.11e-29 105 60 1 94 3 rplW Large ribosomal subunit protein uL23 Gluconobacter oxydans (strain 621H)
A1TYJ9 3.08e-29 103 57 1 95 3 rplW Large ribosomal subunit protein uL23 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B2FQ47 3.29e-29 103 52 0 99 3 rplW Large ribosomal subunit protein uL23 Stenotrophomonas maltophilia (strain K279a)
B4SKW5 3.29e-29 103 52 0 99 3 rplW Large ribosomal subunit protein uL23 Stenotrophomonas maltophilia (strain R551-3)
B0U0Y7 7.82e-29 102 54 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A1VIQ2 8.67e-29 102 56 0 94 3 rplW Large ribosomal subunit protein uL23 Polaromonas naphthalenivorans (strain CJ2)
Q21M55 1.26e-28 102 59 0 91 3 rplW Large ribosomal subunit protein uL23 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B3PK39 1.53e-28 102 55 0 94 3 rplW Large ribosomal subunit protein uL23 Cellvibrio japonicus (strain Ueda107)
B3E7T7 1.57e-28 101 52 0 89 3 rplW Large ribosomal subunit protein uL23 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q7VQE6 1.74e-28 101 53 2 95 3 rplW Large ribosomal subunit protein uL23 Blochmanniella floridana
Q2S914 1.82e-28 101 53 0 95 3 rplW Large ribosomal subunit protein uL23 Hahella chejuensis (strain KCTC 2396)
A4JAP2 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU29 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q13 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia pseudomallei (strain K96243)
A3NEH7 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia pseudomallei (strain 668)
Q3JMR5 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia pseudomallei (strain 1710b)
A3P0B1 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia pseudomallei (strain 1106a)
Q1BRV0 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia orbicola (strain AU 1054)
B1JU24 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia orbicola (strain MC0-3)
A1V8A1 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia mallei (strain SAVP1)
Q62GK7 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia mallei (strain ATCC 23344)
A2S7H8 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia mallei (strain NCTC 10229)
A3MRV6 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia mallei (strain NCTC 10247)
A9ADJ5 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KG5 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ44 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C2 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3M7 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia cenocepacia (strain HI2424)
B1YRD2 8.68e-28 100 54 0 92 3 rplW Large ribosomal subunit protein uL23 Burkholderia ambifaria (strain MC40-6)
A4IZT2 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNS5 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4I5 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. novicida (strain U112)
B2SDY3 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5G8 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. holarctica (strain LVS)
A7N9S8 1.79e-27 99 53 0 98 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q21RW0 1.89e-27 99 54 0 96 3 rplW Large ribosomal subunit protein uL23 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9K1I6 2.32e-27 99 55 0 94 1 rplW Large ribosomal subunit protein uL23 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B2JIG4 2.4e-27 99 54 0 92 3 rplW Large ribosomal subunit protein uL23 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q12GW9 3e-27 99 54 0 94 3 rplW Large ribosomal subunit protein uL23 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A6W390 3.1e-27 98 56 0 92 3 rplW Large ribosomal subunit protein uL23 Marinomonas sp. (strain MWYL1)
B1Y8I5 4.11e-27 98 56 0 96 3 rplW Large ribosomal subunit protein uL23 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q13TH2 4.57e-27 98 53 0 92 3 rplW Large ribosomal subunit protein uL23 Paraburkholderia xenovorans (strain LB400)
B2T749 4.57e-27 98 53 0 92 3 rplW Large ribosomal subunit protein uL23 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B5ELY1 1.63e-26 96 54 0 91 3 rplW Large ribosomal subunit protein uL23 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J469 1.63e-26 96 54 0 91 3 rplW Large ribosomal subunit protein uL23 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q748Z1 2.14e-26 96 51 0 89 3 rplW Large ribosomal subunit protein uL23 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9H3Q8 2.98e-26 96 57 1 91 3 rplW Large ribosomal subunit protein uL23 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5NHW6 3.14e-26 95 52 0 97 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JB8 3.14e-26 95 52 0 97 3 rplW Large ribosomal subunit protein uL23 Francisella tularensis subsp. tularensis (strain FSC 198)
Q1R0H3 4.33e-26 95 54 1 99 3 rplW Large ribosomal subunit protein uL23 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q39Y04 1.35e-25 94 51 0 89 3 rplW Large ribosomal subunit protein uL23 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q31IY0 1.52e-25 94 49 0 97 3 rplW Large ribosomal subunit protein uL23 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B2UEL7 1.8e-25 94 54 0 92 3 rplW Large ribosomal subunit protein uL23 Ralstonia pickettii (strain 12J)
B3R7S1 2.03e-25 94 53 0 92 3 rplW Large ribosomal subunit protein uL23 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46WE6 2.03e-25 94 53 0 92 3 rplW Large ribosomal subunit protein uL23 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K621 2.03e-25 94 53 0 92 3 rplW Large ribosomal subunit protein uL23 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LI39 2.03e-25 94 53 0 92 3 rplW Large ribosomal subunit protein uL23 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2W2J3 2.69e-25 94 54 1 98 3 rplW Large ribosomal subunit protein uL23 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q11HQ4 5.26e-25 92 55 1 93 3 rplW Large ribosomal subunit protein uL23 Chelativorans sp. (strain BNC1)
Q0AIJ3 1.02e-24 92 46 1 97 3 rplW Large ribosomal subunit protein uL23 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2YAZ5 1.18e-24 92 50 1 94 3 rplW Large ribosomal subunit protein uL23 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8XV14 1.37e-24 92 52 0 92 3 rplW Large ribosomal subunit protein uL23 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q3A6P5 1.38e-24 91 50 0 91 3 rplW Large ribosomal subunit protein uL23 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q0BUP8 2.03e-24 92 56 1 91 3 rplW Large ribosomal subunit protein uL23 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B0U5A9 2.12e-24 91 52 0 90 3 rplW Large ribosomal subunit protein uL23 Xylella fastidiosa (strain M12)
Q9PE74 2.12e-24 91 52 0 90 3 rplW Large ribosomal subunit protein uL23 Xylella fastidiosa (strain 9a5c)
Q2RQW2 2.65e-24 91 53 1 97 3 rplW Large ribosomal subunit protein uL23 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q87E80 2.67e-24 91 52 0 90 3 rplW Large ribosomal subunit protein uL23 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8H1 2.67e-24 91 52 0 90 3 rplW Large ribosomal subunit protein uL23 Xylella fastidiosa (strain M23)
B8IS87 3.79e-24 90 54 3 99 3 rplW Large ribosomal subunit protein uL23 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A9NAM6 3.97e-24 90 51 1 97 3 rplW Large ribosomal subunit protein uL23 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD29 3.97e-24 90 51 1 97 3 rplW Large ribosomal subunit protein uL23 Coxiella burnetii (strain Dugway 5J108-111)
B6J261 3.97e-24 90 51 1 97 3 rplW Large ribosomal subunit protein uL23 Coxiella burnetii (strain CbuG_Q212)
B6J5D4 3.97e-24 90 51 1 97 3 rplW Large ribosomal subunit protein uL23 Coxiella burnetii (strain CbuK_Q154)
B0UHW7 6.47e-24 90 53 3 99 3 rplW Large ribosomal subunit protein uL23 Methylobacterium sp. (strain 4-46)
A5GAW7 7.61e-24 89 48 0 90 3 rplW Large ribosomal subunit protein uL23 Geotalea uraniireducens (strain Rf4)
Q1GPA1 1.12e-23 89 53 1 95 3 rplW Large ribosomal subunit protein uL23 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q6F7R4 1.21e-23 89 53 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V6X0 1.39e-23 89 52 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain AYE)
A3M981 1.39e-23 89 52 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZM0 1.39e-23 89 52 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain ACICU)
B7IA37 1.39e-23 89 52 0 94 1 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain AB0057)
B7GW04 1.39e-23 89 52 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain AB307-0294)
Q83ES2 1.51e-23 89 50 1 97 3 rplW Large ribosomal subunit protein uL23 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q82X86 1.63e-23 89 44 1 97 3 rplW Large ribosomal subunit protein uL23 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A6T3K2 1.78e-23 89 52 0 92 3 rplW Large ribosomal subunit protein uL23 Janthinobacterium sp. (strain Marseille)
C6E4Q5 1.86e-23 89 48 0 90 3 rplW Large ribosomal subunit protein uL23 Geobacter sp. (strain M21)
B5EFQ2 1.86e-23 89 48 0 90 3 rplW Large ribosomal subunit protein uL23 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A4G9T6 3.43e-23 88 52 0 92 3 rplW Large ribosomal subunit protein uL23 Herminiimonas arsenicoxydans
Q98N55 3.9e-23 88 52 1 93 3 rplW Large ribosomal subunit protein uL23 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2G8X8 5.82e-23 87 52 1 95 3 rplW Large ribosomal subunit protein uL23 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B0T2C4 7.72e-23 87 50 1 98 3 rplW Large ribosomal subunit protein uL23 Caulobacter sp. (strain K31)
B8H4D6 8.52e-23 87 50 1 98 3 rplW Large ribosomal subunit protein uL23 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8V1 8.52e-23 87 50 1 98 3 rplW Large ribosomal subunit protein uL23 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q211F0 9.56e-23 87 52 1 95 3 rplW Large ribosomal subunit protein uL23 Rhodopseudomonas palustris (strain BisB18)
A4SUW3 1.73e-22 86 47 0 92 3 rplW Large ribosomal subunit protein uL23 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8YHN8 2.01e-22 86 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ9 2.01e-22 86 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella melitensis biotype 2 (strain ATCC 23457)
Q5WZL0 2.02e-22 86 54 0 92 3 rplW Large ribosomal subunit protein uL23 Legionella pneumophila (strain Lens)
Q5ZYP1 2.02e-22 86 54 0 92 3 rplW Large ribosomal subunit protein uL23 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHR2 2.02e-22 86 54 0 92 3 rplW Large ribosomal subunit protein uL23 Legionella pneumophila (strain Corby)
Q5X857 2.02e-22 86 54 0 92 3 rplW Large ribosomal subunit protein uL23 Legionella pneumophila (strain Paris)
B1XSQ3 2.8e-22 86 47 0 92 3 rplW Large ribosomal subunit protein uL23 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q2L2F4 3.19e-22 85 58 0 91 3 rplW Large ribosomal subunit protein uL23 Bordetella avium (strain 197N)
B0CH30 4.31e-22 85 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella suis (strain ATCC 23445 / NCTC 10510)
B1ZLK6 5.05e-22 85 52 3 99 3 rplW Large ribosomal subunit protein uL23 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A5WCJ2 7.45e-22 85 51 1 96 3 rplW Large ribosomal subunit protein uL23 Psychrobacter sp. (strain PRwf-1)
Q605B4 7.53e-22 84 49 0 89 3 rplW Large ribosomal subunit protein uL23 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6X0C0 7.7e-22 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6FZC4 9.07e-22 84 48 1 97 3 rplW Large ribosomal subunit protein uL23 Bartonella quintana (strain Toulouse)
C0Q9X1 1.03e-21 84 44 0 93 3 rplW Large ribosomal subunit protein uL23 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B0VQS0 1.04e-21 84 51 0 94 3 rplW Large ribosomal subunit protein uL23 Acinetobacter baumannii (strain SDF)
Q1QDI4 1.04e-21 85 48 1 96 3 rplW Large ribosomal subunit protein uL23 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF4 1.04e-21 85 48 1 96 3 rplW Large ribosomal subunit protein uL23 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B5ZYT7 1.06e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MID9 1.06e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K9L4 1.06e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWS3 1.06e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium etli (strain CIAT 652)
A9IIZ8 1.13e-21 84 57 0 91 3 rplW Large ribosomal subunit protein uL23 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q8G078 1.23e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella suis biovar 1 (strain 1330)
A5VR04 1.23e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M5P8 1.23e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CR0 1.26e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella abortus biovar 1 (strain 9-941)
Q2YM05 1.26e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella abortus (strain 2308)
B2S677 1.26e-21 84 53 1 93 3 rplW Large ribosomal subunit protein uL23 Brucella abortus (strain S19)
Q3SSW4 1.35e-21 84 53 1 89 3 rplW Large ribosomal subunit protein uL23 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QN28 2.21e-21 83 48 1 98 3 rplW Large ribosomal subunit protein uL23 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A9W4Q3 2.23e-21 83 50 3 99 3 rplW Large ribosomal subunit protein uL23 Methylorubrum extorquens (strain PA1)
B7L0R3 2.23e-21 83 50 3 99 3 rplW Large ribosomal subunit protein uL23 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9IW25 2.27e-21 83 51 1 93 3 rplW Large ribosomal subunit protein uL23 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A1AVK2 2.75e-21 83 50 1 93 3 rplW Large ribosomal subunit protein uL23 Ruthia magnifica subsp. Calyptogena magnifica
Q1GK35 2.87e-21 83 50 1 89 3 rplW Large ribosomal subunit protein uL23 Ruegeria sp. (strain TM1040)
Q5LLU8 3.16e-21 83 49 1 89 3 rplW Large ribosomal subunit protein uL23 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9JDT0 3.71e-21 83 52 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q7VTD1 3.98e-21 83 54 0 91 3 rplW Large ribosomal subunit protein uL23 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2F4 3.98e-21 83 54 0 91 3 rplW Large ribosomal subunit protein uL23 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRC3 3.98e-21 83 54 0 91 3 rplW Large ribosomal subunit protein uL23 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2IXQ8 4.41e-21 83 50 1 95 3 rplW Large ribosomal subunit protein uL23 Rhodopseudomonas palustris (strain HaA2)
Q134T1 5.37e-21 82 50 1 95 3 rplW Large ribosomal subunit protein uL23 Rhodopseudomonas palustris (strain BisB5)
Q6G2W7 5.55e-21 82 50 1 93 3 rplW Large ribosomal subunit protein uL23 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8D210 5.79e-21 82 42 0 98 3 rplW Large ribosomal subunit protein uL23 Wigglesworthia glossinidia brevipalpis
Q6N4T7 7.78e-21 82 50 1 95 1 rplW Large ribosomal subunit protein uL23 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A0L5X5 8.04e-21 82 48 1 95 3 rplW Large ribosomal subunit protein uL23 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1B029 1.03e-20 82 51 1 89 3 rplW Large ribosomal subunit protein uL23 Paracoccus denitrificans (strain Pd 1222)
Q9JX11 1.13e-20 82 54 0 94 3 rplW Large ribosomal subunit protein uL23 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B8FET3 1.18e-20 81 44 0 92 3 rplW Large ribosomal subunit protein uL23 Desulfatibacillum aliphaticivorans
Q5GWT6 1.53e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQR2 1.53e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZY7 1.53e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWY1 1.53e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNS2 1.53e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas axonopodis pv. citri (strain 306)
A8ZV59 1.57e-20 81 46 0 89 3 rplW Large ribosomal subunit protein uL23 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8PC47 1.69e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU80 1.69e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas campestris pv. campestris (strain B100)
Q4URE1 1.69e-20 81 49 0 99 3 rplW Large ribosomal subunit protein uL23 Xanthomonas campestris pv. campestris (strain 8004)
B9JVN9 1.77e-20 81 51 1 93 3 rplW Large ribosomal subunit protein uL23 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C3MAY2 2.01e-20 81 50 1 93 3 rplW Large ribosomal subunit protein uL23 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5F5S9 2.25e-20 81 53 0 94 3 rplW Large ribosomal subunit protein uL23 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q28UW0 2.26e-20 81 45 1 98 3 rplW Large ribosomal subunit protein uL23 Jannaschia sp. (strain CCS1)
Q2IJ87 2.45e-20 81 47 0 89 3 rplW Large ribosomal subunit protein uL23 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q89J86 2.46e-20 81 49 1 95 3 rplW Large ribosomal subunit protein uL23 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8LM50 2.54e-20 80 50 1 89 3 rplW Large ribosomal subunit protein uL23 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q16AF2 2.84e-20 80 49 1 89 3 rplW Large ribosomal subunit protein uL23 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B1LWS8 3.2e-20 80 47 1 98 3 rplW Large ribosomal subunit protein uL23 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A6U861 3.83e-20 80 50 1 93 3 rplW Large ribosomal subunit protein uL23 Sinorhizobium medicae (strain WSM419)
Q92QG8 3.83e-20 80 50 1 93 3 rplW Large ribosomal subunit protein uL23 Rhizobium meliloti (strain 1021)
B4UBA1 3.87e-20 80 47 0 89 3 rplW Large ribosomal subunit protein uL23 Anaeromyxobacter sp. (strain K)
B8J862 3.87e-20 80 47 0 89 3 rplW Large ribosomal subunit protein uL23 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q01W94 5.32e-20 80 46 1 90 3 rplW Large ribosomal subunit protein uL23 Solibacter usitatus (strain Ellin6076)
A1KRH5 7.7e-20 80 53 0 94 3 rplW Large ribosomal subunit protein uL23 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A5USI7 7.76e-20 79 40 1 91 3 rplW Large ribosomal subunit protein uL23 Roseiflexus sp. (strain RS-1)
Q8UE20 7.87e-20 79 50 1 93 3 rplW Large ribosomal subunit protein uL23 Agrobacterium fabrum (strain C58 / ATCC 33970)
B0RZU2 1.31e-19 79 48 2 90 3 rplW Large ribosomal subunit protein uL23 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q0BYB6 1.8e-19 79 53 1 89 3 rplW Large ribosomal subunit protein uL23 Hyphomonas neptunium (strain ATCC 15444)
Q5NQ62 2.09e-19 79 52 1 93 3 rplW Large ribosomal subunit protein uL23 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A7HBM0 4.36e-19 77 44 0 89 3 rplW Large ribosomal subunit protein uL23 Anaeromyxobacter sp. (strain Fw109-5)
Q1D773 4.51e-19 77 45 1 94 3 rplW Large ribosomal subunit protein uL23 Myxococcus xanthus (strain DK1622)
O66433 5.76e-19 77 47 1 90 3 rplW Large ribosomal subunit protein uL23 Aquifex aeolicus (strain VF5)
A6TWI0 6.09e-19 77 51 3 91 3 rplW Large ribosomal subunit protein uL23 Alkaliphilus metalliredigens (strain QYMF)
A7NR61 8.28e-19 77 40 1 91 3 rplW Large ribosomal subunit protein uL23 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q9ZI48 1.2e-18 77 51 1 86 3 rplW Large ribosomal subunit protein uL23 Aquifex pyrophilus
A0LIJ2 2.01e-18 76 42 0 94 3 rplW Large ribosomal subunit protein uL23 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B9KL93 4.19e-18 75 51 1 89 3 rplW Large ribosomal subunit protein uL23 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5S0 4.19e-18 75 51 1 89 3 rplW Large ribosomal subunit protein uL23 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGL3 4.19e-18 75 51 1 89 3 rplW Large ribosomal subunit protein uL23 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A5CXK6 4.38e-18 75 48 1 93 3 rplW Large ribosomal subunit protein uL23 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A6LPR3 1.07e-17 74 47 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q1ISC0 1.55e-17 73 45 0 86 3 rplW Large ribosomal subunit protein uL23 Koribacter versatilis (strain Ellin345)
A4WVK6 2.24e-17 73 52 1 89 3 rplW Large ribosomal subunit protein uL23 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q9RXK0 2.41e-17 73 46 1 89 1 rplW Large ribosomal subunit protein uL23 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7UN18 2.83e-17 73 43 0 87 3 rplW Large ribosomal subunit protein uL23 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q67JU5 6.41e-17 72 42 1 89 3 rplW Large ribosomal subunit protein uL23 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B4U746 7.37e-17 72 44 1 92 3 rplW Large ribosomal subunit protein uL23 Hydrogenobaculum sp. (strain Y04AAS1)
A5D5J2 8.45e-17 72 46 1 89 3 rplW Large ribosomal subunit protein uL23 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A9ETE3 8.46e-17 72 39 1 88 3 rplW Large ribosomal subunit protein uL23 Sorangium cellulosum (strain So ce56)
Q3APH5 1.6e-16 71 44 1 92 3 rplW Large ribosomal subunit protein uL23 Chlorobium chlorochromatii (strain CaD3)
Q8FS78 1.76e-16 71 47 2 91 3 rplW Large ribosomal subunit protein uL23 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0SQE6 2.25e-16 70 42 2 92 3 rplW Large ribosomal subunit protein uL23 Clostridium perfringens (strain SM101 / Type A)
Q8XHS5 2.25e-16 70 42 2 92 3 rplW Large ribosomal subunit protein uL23 Clostridium perfringens (strain 13 / Type A)
Q0TMP8 2.25e-16 70 42 2 92 3 rplW Large ribosomal subunit protein uL23 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B4S5M5 3.05e-16 70 43 1 93 3 rplW Large ribosomal subunit protein uL23 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B2UYB2 3.72e-16 70 44 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Alaska E43 / Type E3)
Q6NJD2 4.06e-16 70 47 2 90 3 rplW Large ribosomal subunit protein uL23 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6A6M8 4.07e-16 70 42 2 98 1 rplW Large ribosomal subunit protein uL23 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q30Z44 4.16e-16 70 43 1 91 3 rplW Large ribosomal subunit protein uL23 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q6AP69 6.2e-16 69 45 0 82 3 rplW Large ribosomal subunit protein uL23 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B2TIH7 7.71e-16 69 44 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Eklund 17B / Type B)
A5GVW2 8.11e-16 69 46 1 88 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain RCC307)
Q0ANQ2 1.18e-15 69 45 1 93 3 rplW Large ribosomal subunit protein uL23 Maricaulis maris (strain MCS10)
C1CXG4 1.36e-15 68 44 1 84 3 rplW Large ribosomal subunit protein uL23 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q1RHM3 1.4e-15 68 44 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia bellii (strain RML369-C)
A8GVB6 1.4e-15 68 44 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia bellii (strain OSU 85-389)
Q2LQ99 1.57e-15 68 38 0 93 3 rplW Large ribosomal subunit protein uL23 Syntrophus aciditrophicus (strain SB)
B2A4E1 1.59e-15 68 47 1 80 3 rplW Large ribosomal subunit protein uL23 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
P73318 1.78e-15 68 44 1 93 3 rplW Large ribosomal subunit protein uL23 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3A9R8 1.78e-15 68 45 1 86 3 rplW Large ribosomal subunit protein uL23 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A8G760 2.04e-15 68 44 1 90 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9215)
Q8NT06 2.1e-15 68 45 2 91 3 rplW Large ribosomal subunit protein uL23 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBI2 2.1e-15 68 45 2 91 3 rplW Large ribosomal subunit protein uL23 Corynebacterium glutamicum (strain R)
B3EGY8 2.13e-15 68 42 1 90 3 rplW Large ribosomal subunit protein uL23 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q2RFP9 2.3e-15 68 48 1 87 3 rplW Large ribosomal subunit protein uL23 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B1WQR2 2.38e-15 68 43 1 82 3 rplW Large ribosomal subunit protein uL23 Crocosphaera subtropica (strain ATCC 51142 / BH68)
B3QR78 2.47e-15 68 43 1 89 3 rplW Large ribosomal subunit protein uL23 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A4J113 2.91e-15 68 47 1 89 3 rplW Large ribosomal subunit protein uL23 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C4LL50 2.94e-15 68 46 2 91 3 rplW Large ribosomal subunit protein uL23 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A2BYT4 3.19e-15 68 43 1 90 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9515)
C3PKQ4 3.76e-15 67 46 2 89 3 rplW Large ribosomal subunit protein uL23 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A2BTD5 3.88e-15 67 44 1 90 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain AS9601)
Q7UZU9 3.88e-15 67 41 1 90 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q7V540 4.62e-15 67 41 1 89 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9313)
Q7V9W4 4.7e-15 67 40 1 96 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q318I6 5.5e-15 67 43 1 90 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9312)
B4SBU9 5.86e-15 67 39 1 93 3 rplW Large ribosomal subunit protein uL23 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q3AUW1 5.99e-15 67 41 1 90 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain CC9902)
Q46IR1 6.05e-15 67 40 1 97 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain NATL2A)
A2C4Z7 6.05e-15 67 40 1 97 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain NATL1A)
Q0ID07 6.06e-15 67 43 1 88 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain CC9311)
A8EZL4 6.43e-15 67 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia canadensis (strain McKiel)
Q7U4J8 6.9e-15 67 42 1 88 3 rplW Large ribosomal subunit protein uL23 Parasynechococcus marenigrum (strain WH8102)
B0TC58 7.33e-15 67 46 1 89 3 rplW Large ribosomal subunit protein uL23 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q3B6F9 7.6e-15 67 41 1 90 3 rplW Large ribosomal subunit protein uL23 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3AMN2 7.7e-15 67 42 1 88 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain CC9605)
B7GND8 8.71e-15 67 44 1 88 3 rplW Large ribosomal subunit protein uL23 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G415 8.71e-15 67 44 1 88 3 rplW Large ribosomal subunit protein uL23 Bifidobacterium longum (strain NCC 2705)
B3DQ15 8.71e-15 67 44 1 88 3 rplW Large ribosomal subunit protein uL23 Bifidobacterium longum (strain DJO10A)
A2CC29 9.26e-15 67 42 1 88 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9303)
Q1AU31 1.05e-14 66 42 0 90 3 rplW Large ribosomal subunit protein uL23 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q6MSM7 1.06e-14 66 43 1 89 3 rplW Large ribosomal subunit protein uL23 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P10140 1.06e-14 66 43 1 89 3 rplW Large ribosomal subunit protein uL23 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
C4K2H7 1.08e-14 66 44 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia peacockii (strain Rustic)
C5CGR2 1.25e-14 66 44 1 92 3 rplW Large ribosomal subunit protein uL23 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A3PF45 1.31e-14 66 43 1 89 3 rplW Large ribosomal subunit protein uL23 Prochlorococcus marinus (strain MIT 9301)
A5GIU3 1.66e-14 66 43 1 88 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain WH7803)
Q1IX74 2.04e-14 65 45 1 84 3 rplW Large ribosomal subunit protein uL23 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B2UMT8 2.39e-14 65 43 1 91 3 rplW Large ribosomal subunit protein uL23 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q92GW8 2.53e-14 65 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PPA5 2.53e-14 65 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia africae (strain ESF-5)
Q4UMS7 2.55e-14 65 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8GT67 3.43e-14 65 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia rickettsii (strain Sheila Smith)
B0BUQ8 3.43e-14 65 43 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia rickettsii (strain Iowa)
A9B414 3.46e-14 65 43 2 86 3 rplW Large ribosomal subunit protein uL23 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
O32983 3.97e-14 65 43 2 89 3 rplW Large ribosomal subunit protein uL23 Mycobacterium leprae (strain TN)
B8ZSB7 3.97e-14 65 43 2 89 3 rplW Large ribosomal subunit protein uL23 Mycobacterium leprae (strain Br4923)
B8DW15 4.49e-14 65 43 1 88 3 rplW Large ribosomal subunit protein uL23 Bifidobacterium animalis subsp. lactis (strain AD011)
C0ZII2 4.77e-14 65 45 2 93 3 rplW Large ribosomal subunit protein uL23 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B3QY26 4.89e-14 65 42 1 88 3 rplW Large ribosomal subunit protein uL23 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B8IYH4 4.93e-14 65 41 1 90 3 rplW Large ribosomal subunit protein uL23 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q110A9 5e-14 65 40 1 87 3 rplW Large ribosomal subunit protein uL23 Trichodesmium erythraeum (strain IMS101)
A1BJ32 6.67e-14 64 41 1 93 3 rplW Large ribosomal subunit protein uL23 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q7NPG8 8.12e-14 64 39 1 87 3 rplW Large ribosomal subunit protein uL23 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q250N0 1.05e-13 64 47 1 89 3 rplW Large ribosomal subunit protein uL23 Desulfitobacterium hafniense (strain Y51)
B8DN98 1.09e-13 64 45 1 91 3 rplW Large ribosomal subunit protein uL23 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q2JV83 1.2e-13 63 42 2 96 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain JA-3-3Ab)
B2V7L1 1.34e-13 63 42 1 90 3 rplW Large ribosomal subunit protein uL23 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q18CF8 1.46e-13 63 49 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridioides difficile (strain 630)
B1I1J0 1.52e-13 63 43 1 90 3 rplW Large ribosomal subunit protein uL23 Desulforudis audaxviator (strain MP104C)
B5YG45 1.57e-13 63 37 0 93 3 rplW Large ribosomal subunit protein uL23 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q73PN0 1.65e-13 63 43 1 90 3 rplW Large ribosomal subunit protein uL23 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A0PXU8 1.77e-13 63 43 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium novyi (strain NT)
B0C1D5 1.89e-13 63 45 1 81 3 rplW Large ribosomal subunit protein uL23 Acaryochloris marina (strain MBIC 11017)
Q9ZCQ7 2.19e-13 63 40 1 89 3 rplW Large ribosomal subunit protein uL23 Rickettsia prowazekii (strain Madrid E)
A8MLE2 2.48e-13 63 41 2 90 3 rplW Large ribosomal subunit protein uL23 Alkaliphilus oremlandii (strain OhILAs)
B1KSM3 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ72 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGF2 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Okra / Type B1)
C1FMU9 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Kyoto / Type A2)
A5I7K4 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVP9 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ67 2.52e-13 63 40 3 91 3 rplW Large ribosomal subunit protein uL23 Clostridium botulinum (strain ATCC 19397 / Type A)
A4SCR1 2.56e-13 63 43 1 93 3 rplW Large ribosomal subunit protein uL23 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B7K333 3.37e-13 63 43 1 80 3 rplW Large ribosomal subunit protein uL23 Rippkaea orientalis (strain PCC 8801 / RF-1)
B2ITQ3 3.83e-13 62 44 1 84 3 rplW Large ribosomal subunit protein uL23 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8KAH4 5.35e-13 62 41 1 89 3 rplW Large ribosomal subunit protein uL23 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1GZ85 5.55e-13 62 45 2 88 3 rplW Large ribosomal subunit protein uL23 Endomicrobium trichonymphae
Q0AUI2 5.71e-13 62 39 1 89 3 rplW Large ribosomal subunit protein uL23 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A4FPM3 5.97e-13 62 41 3 100 3 rplW Large ribosomal subunit protein uL23 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q3Z979 6.22e-13 62 41 1 92 3 rplW Large ribosomal subunit protein uL23 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q68W80 7.39e-13 62 37 1 93 3 rplW Large ribosomal subunit protein uL23 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B8G1W8 7.91e-13 62 46 1 89 3 rplW Large ribosomal subunit protein uL23 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2JIM5 8.08e-13 62 42 2 94 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q9RA57 8.29e-13 62 46 1 89 1 rplW Large ribosomal subunit protein uL23 Thermus thermophilus
Q5SHP0 8.29e-13 62 46 1 89 1 rplW Large ribosomal subunit protein uL23 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I06 8.29e-13 62 46 1 89 1 rplW Large ribosomal subunit protein uL23 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8YPI1 8.63e-13 62 41 1 84 3 rplW Large ribosomal subunit protein uL23 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q03ZP3 9.62e-13 61 47 1 78 3 rplW Large ribosomal subunit protein uL23 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q2NIV6 1.01e-12 61 39 0 89 3 rplW Large ribosomal subunit protein uL23 Aster yellows witches'-broom phytoplasma (strain AYWB)
C6C187 1.08e-12 61 38 1 91 3 rplW Large ribosomal subunit protein uL23 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A5N4P9 1.33e-12 61 41 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYB1 1.33e-12 61 41 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium kluyveri (strain NBRC 12016)
Q6YR18 1.44e-12 61 38 0 89 3 rplW Large ribosomal subunit protein uL23 Onion yellows phytoplasma (strain OY-M)
Q3MFB9 1.45e-12 61 41 1 84 3 rplW Large ribosomal subunit protein uL23 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q73SB2 1.57e-12 61 39 2 91 3 rplW Large ribosomal subunit protein uL23 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL16 1.57e-12 61 39 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium avium (strain 104)
A0PM65 1.71e-12 61 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium ulcerans (strain Agy99)
B1MGE8 1.85e-12 61 39 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A1T4P1 1.87e-12 61 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1BDA5 1.97e-12 60 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium sp. (strain MCS)
A1UBN8 1.97e-12 60 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium sp. (strain KMS)
A3PVC3 1.97e-12 60 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium sp. (strain JLS)
Q3ZZM2 2.39e-12 60 40 1 92 3 rplW Large ribosomal subunit protein uL23 Dehalococcoides mccartyi (strain CBDB1)
A5FRZ1 2.39e-12 60 40 1 92 3 rplW Large ribosomal subunit protein uL23 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A8GPE8 2.54e-12 60 39 1 93 3 rplW Large ribosomal subunit protein uL23 Rickettsia akari (strain Hartford)
Q6B8V5 2.8e-12 60 32 1 97 3 rpl23 Large ribosomal subunit protein uL23c Gracilaria tenuistipitata var. liui
A3DJH4 2.86e-12 61 46 1 78 3 rplW Large ribosomal subunit protein uL23 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A8LC54 2.87e-12 60 40 3 99 3 rplW Large ribosomal subunit protein uL23 Parafrankia sp. (strain EAN1pec)
Q4JT49 3.58e-12 60 42 2 91 3 rplW Large ribosomal subunit protein uL23 Corynebacterium jeikeium (strain K411)
B9K888 4.39e-12 60 44 1 92 3 rplW Large ribosomal subunit protein uL23 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A0LRM2 4.57e-12 60 39 1 88 3 rplW Large ribosomal subunit protein uL23 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B2HSN3 5.34e-12 60 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium marinum (strain ATCC BAA-535 / M)
C4XLX5 6.16e-12 59 41 1 90 3 rplW Large ribosomal subunit protein uL23 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
O24691 6.49e-12 59 39 1 87 3 rplW Large ribosomal subunit protein uL23 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L09 6.49e-12 59 39 1 87 3 rplW Large ribosomal subunit protein uL23 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q97EI0 7.28e-12 59 40 3 93 3 rplW Large ribosomal subunit protein uL23 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1LBN8 7.31e-12 59 46 1 89 3 rplW Large ribosomal subunit protein uL23 Thermotoga sp. (strain RQ2)
A5IM85 7.31e-12 59 46 1 89 3 rplW Large ribosomal subunit protein uL23 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P38512 7.31e-12 59 46 1 89 3 rplW Large ribosomal subunit protein uL23 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6F1Z2 7.87e-12 59 36 1 90 3 rplW Large ribosomal subunit protein uL23 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q0RRR9 7.94e-12 59 38 2 99 3 rplW Large ribosomal subunit protein uL23 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B1MW12 8.06e-12 59 44 1 78 3 rplW Large ribosomal subunit protein uL23 Leuconostoc citreum (strain KM20)
B8HD04 8.8e-12 59 44 2 90 3 rplW Large ribosomal subunit protein uL23 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A0JZ82 8.8e-12 59 44 2 90 3 rplW Large ribosomal subunit protein uL23 Arthrobacter sp. (strain FB24)
A0QSD3 9.79e-12 59 39 2 91 1 rplW Large ribosomal subunit protein uL23 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2JFH4 1.02e-11 59 38 2 99 3 rplW Large ribosomal subunit protein uL23 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0T0X4 1.11e-11 58 37 1 90 3 rpl23 Large ribosomal subunit protein uL23c Thalassiosira pseudonana
O46896 1.14e-11 58 35 1 91 3 rpl23 Large ribosomal subunit protein uL23c Guillardia theta
C0ZW27 1.14e-11 58 41 2 91 3 rplW Large ribosomal subunit protein uL23 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
P9WHB9 1.78e-11 58 40 2 91 1 rplW Large ribosomal subunit protein uL23 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHB8 1.78e-11 58 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U089 1.78e-11 58 40 2 91 1 rplW Large ribosomal subunit protein uL23 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL37 1.78e-11 58 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGI4 1.78e-11 58 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
O06046 1.78e-11 58 40 2 91 3 rplW Large ribosomal subunit protein uL23 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8ETY0 2.02e-11 58 45 3 91 3 rplW Large ribosomal subunit protein uL23 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1R8U3 2.05e-11 58 43 2 90 3 rplW Large ribosomal subunit protein uL23 Paenarthrobacter aurescens (strain TC1)
Q02W26 2.15e-11 58 43 1 83 3 rplW Large ribosomal subunit protein uL23 Lactococcus lactis subsp. cremoris (strain SK11)
Q661E0 2.24e-11 58 38 2 91 3 rplW Large ribosomal subunit protein uL23 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A8F4R3 2.62e-11 58 43 1 91 3 rplW Large ribosomal subunit protein uL23 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B9DM17 2.81e-11 57 43 1 81 3 rplW Large ribosomal subunit protein uL23 Staphylococcus carnosus (strain TM300)
B7J245 2.82e-11 58 38 2 91 3 rplW Large ribosomal subunit protein uL23 Borreliella burgdorferi (strain ZS7)
P94269 2.82e-11 58 38 2 91 1 rplW Large ribosomal subunit protein uL23 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SN27 2.82e-11 58 38 2 91 3 rplW Large ribosomal subunit protein uL23 Borreliella afzelii (strain PKo)
A1VEB4 2.96e-11 57 40 1 91 3 rplW Large ribosomal subunit protein uL23 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH8 2.96e-11 57 40 1 91 3 rplW Large ribosomal subunit protein uL23 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C1B014 3.67e-11 57 40 2 91 3 rplW Large ribosomal subunit protein uL23 Rhodococcus opacus (strain B4)
Q0S3H4 3.67e-11 57 40 2 91 3 rplW Large ribosomal subunit protein uL23 Rhodococcus jostii (strain RHA1)
P51312 5.41e-11 57 32 1 94 3 rpl23 Large ribosomal subunit protein uL23c Porphyra purpurea
B3EP59 5.47e-11 57 35 1 93 3 rplW Large ribosomal subunit protein uL23 Chlorobium phaeobacteroides (strain BS1)
A4T1U0 6.94e-11 57 38 2 91 3 rplW Large ribosomal subunit protein uL23 Mycolicibacterium gilvum (strain PYR-GCK)
B2S2D8 1.17e-10 56 42 1 84 3 rplW Large ribosomal subunit protein uL23 Treponema pallidum subsp. pallidum (strain SS14)
O83221 1.17e-10 56 42 1 84 3 rplW Large ribosomal subunit protein uL23 Treponema pallidum (strain Nichols)
P49559 1.19e-10 56 37 1 88 3 rpl23 Large ribosomal subunit protein uL23c Trieres chinensis
Q6MJ16 1.38e-10 56 37 1 90 3 rplW Large ribosomal subunit protein uL23 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5Z1W1 1.6e-10 56 39 2 91 3 rplW Large ribosomal subunit protein uL23 Nocardia farcinica (strain IFM 10152)
Q4L8B2 2.25e-10 55 41 1 81 3 rplW Large ribosomal subunit protein uL23 Staphylococcus haemolyticus (strain JCSC1435)
Q9Z9L2 2.39e-10 55 40 3 91 3 rplW Large ribosomal subunit protein uL23 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1XDH6 2.94e-10 55 34 1 89 3 rpl23 Large ribosomal subunit protein uL23c Neopyropia yezoensis
B1YGV2 3.02e-10 55 41 3 90 3 rplW Large ribosomal subunit protein uL23 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C5CC60 4.4e-10 55 41 2 90 3 rplW Large ribosomal subunit protein uL23 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A7H654 4.55e-10 54 36 0 74 3 rplW Large ribosomal subunit protein uL23 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5WLR0 4.77e-10 54 39 2 87 3 rplW Large ribosomal subunit protein uL23 Shouchella clausii (strain KSM-K16)
A1W1V8 4.97e-10 54 36 0 74 3 rplW Large ribosomal subunit protein uL23 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FP19 4.97e-10 54 36 0 74 3 rplW Large ribosomal subunit protein uL23 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q046C3 5.11e-10 54 40 2 83 3 rplW Large ribosomal subunit protein uL23 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A0T0I0 5.24e-10 54 37 1 82 3 rpl23 Large ribosomal subunit protein uL23c Phaeodactylum tricornutum (strain CCAP 1055/1)
Q8CRG2 6.08e-10 54 40 1 81 3 rplW Large ribosomal subunit protein uL23 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM01 6.08e-10 54 40 1 81 3 rplW Large ribosomal subunit protein uL23 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q74L87 6.76e-10 54 39 2 83 3 rplW Large ribosomal subunit protein uL23 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6KI53 8.44e-10 56 41 1 82 3 rplW Large ribosomal subunit protein uL23 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q6ACZ7 9.67e-10 53 41 1 82 3 rplW Large ribosomal subunit protein uL23 Leifsonia xyli subsp. xyli (strain CTCB07)
Q04C13 1.04e-09 53 38 2 83 3 rplW Large ribosomal subunit protein uL23 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL6 1.04e-09 53 38 2 83 3 rplW Large ribosomal subunit protein uL23 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P54016 1.13e-09 53 40 2 86 3 rpl23 Large ribosomal subunit protein uL23 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B9E9J3 1.21e-09 53 36 2 88 3 rplW Large ribosomal subunit protein uL23 Macrococcus caseolyticus (strain JCSC5402)
Q8R7V6 1.24e-09 53 41 3 89 3 rplW Large ribosomal subunit protein uL23 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B1VAE6 1.5e-09 53 37 1 88 3 rplW Large ribosomal subunit protein uL23 Phytoplasma australiense
Q04PU0 1.59e-09 53 42 0 64 3 rplW Large ribosomal subunit protein uL23 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B2GIZ5 1.62e-09 53 41 2 90 3 rplW Large ribosomal subunit protein uL23 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18585
Feature type CDS
Gene rplW
Product 50S ribosomal protein L23
Location 21539 - 21841 (strand: -1)
Length 303 (nucleotides) / 100 (amino acids)
In genomic island -

Contig

Accession ZDB_706
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2430
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00276 Ribosomal protein L23

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0089 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L23

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02892 large subunit ribosomal protein L23 Ribosome -

Protein Sequence

MIREERLLKVLRAPHVSEKASTAMEKTNTIVLKVAKDATKAEIKAAVEKLFEVKVEGVNTLLVKGKVKRHGQRFGRRSDWKKAYVTLQEGQNLDFVGGAE

Flanking regions ( +/- flanking 50bp)

AAAGTAGTGATGACTGCTGAAGCAGTTAAGCAAGTTGAGGAGATGCTGGCATGATCCGTGAAGAACGTCTGCTGAAAGTACTGCGCGCGCCGCATGTATCTGAAAAAGCGTCTACCGCGATGGAAAAAACAAATACCATCGTGCTCAAAGTTGCTAAAGACGCGACTAAAGCTGAAATCAAAGCTGCAGTTGAAAAACTGTTCGAAGTCAAAGTTGAAGGTGTTAACACTCTGCTGGTTAAAGGCAAAGTGAAGCGCCACGGTCAGCGTTTCGGTCGTCGTAGCGACTGGAAAAAAGCTTACGTCACCCTGCAGGAAGGCCAGAATCTGGACTTCGTCGGCGGCGCTGAGTAAGTCGGAGGAGTAAAGAACAATGGCAATTGTTAAATGTAAACCTACGTCTC