Homologs in group_2418

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19175 FBDBKF_19175 100.0 Morganella morganii S1 - Small ribosomal subunit protein uS8
EHELCC_18920 EHELCC_18920 100.0 Morganella morganii S2 - Small ribosomal subunit protein uS8
NLDBIP_18935 NLDBIP_18935 100.0 Morganella morganii S4 - Small ribosomal subunit protein uS8
LHKJJB_18790 LHKJJB_18790 100.0 Morganella morganii S3 - Small ribosomal subunit protein uS8
F4V73_RS18990 F4V73_RS18990 95.4 Morganella psychrotolerans rpsH 30S ribosomal protein S8
PMI_RS16220 PMI_RS16220 97.7 Proteus mirabilis HI4320 rpsH 30S ribosomal protein S8

Distribution of the homologs in the orthogroup group_2418

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2418

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1J8 4.84e-90 259 97 0 130 3 rpsH Small ribosomal subunit protein uS8 Proteus mirabilis (strain HI4320)
B5XNA7 2.81e-88 255 95 0 130 3 rpsH Small ribosomal subunit protein uS8 Klebsiella pneumoniae (strain 342)
Q7MYG5 6.47e-88 254 96 0 130 3 rpsH Small ribosomal subunit protein uS8 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YWV3 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella sonnei (strain Ss046)
P0A7X2 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella flexneri
Q0SZZ6 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella flexneri serotype 5b (strain 8401)
Q32B45 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX0 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella boydii serotype 4 (strain Sb227)
B2U2S4 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7X0 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7X1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella typhi
B4TXC8 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella schwarzengrund (strain CVM19633)
B5BGX2 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella paratyphi A (strain AKU_12601)
A9MSY4 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU7 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUS6 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella newport (strain SL254)
B4TKK1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella heidelberg (strain SL476)
B5RH29 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1G3 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella enteritidis PT4 (strain P125109)
B5FJK0 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella dublin (strain CT_02021853)
Q57J46 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella choleraesuis (strain SC-B67)
B5F7T1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella agona (strain SL483)
B7LRS2 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R622 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain UTI89 / UPEC)
B1LHC0 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain SMS-3-5 / SECEC)
B6I220 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain SE11)
B7NDS7 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7W7 1.26e-87 253 94 0 130 1 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain K12)
B1IPZ3 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7W8 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF5 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ5 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O1:K1 / APEC
A8A5B1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O9:H4 (strain HS)
B1X6F8 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain K12 / DH10B)
C4ZUG1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M0 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O8 (strain IAI1)
B7N190 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O81 (strain ED1a)
B7NLM5 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTM7 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7W9 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O157:H7
B7L4J4 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli (strain 55989 / EAEC)
B7MCS1 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK30 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ5 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQK2 1.26e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VK82 2.31e-87 253 94 0 130 3 rpsH Small ribosomal subunit protein uS8 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WFB4 3.08e-87 252 93 0 130 3 rpsH Small ribosomal subunit protein uS8 Enterobacter sp. (strain 638)
A6TEV8 4e-87 252 93 0 130 3 rpsH Small ribosomal subunit protein uS8 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MPG4 6.63e-87 251 93 0 130 3 rpsH Small ribosomal subunit protein uS8 Cronobacter sakazakii (strain ATCC BAA-894)
C6DG60 1.05e-86 251 95 0 130 3 rpsH Small ribosomal subunit protein uS8 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZY4 2.5e-86 250 93 0 130 3 rpsH Small ribosomal subunit protein uS8 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MN62 2.76e-86 250 93 0 130 3 rpsH Small ribosomal subunit protein uS8 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1JIX5 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T5 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH06 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pestis (strain Pestoides F)
Q1CCV8 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R909 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ98 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pestis
B2K523 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2W1 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNM0 1.53e-85 248 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS16 1.26e-84 246 90 0 130 3 rpsH Small ribosomal subunit protein uS8 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BGL1 1.36e-84 246 92 0 130 3 rpsH Small ribosomal subunit protein uS8 Edwardsiella ictaluri (strain 93-146)
A8GKI3 5.36e-84 244 90 0 130 3 rpsH Small ribosomal subunit protein uS8 Serratia proteamaculans (strain 568)
P46180 6.46e-84 244 91 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Acyrthosiphon kondoi
Q2NQN6 9.75e-81 236 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Sodalis glossinidius (strain morsitans)
Q9CL44 1.34e-79 233 86 0 130 3 rpsH Small ribosomal subunit protein uS8 Pasteurella multocida (strain Pm70)
B0BSU5 1.75e-78 230 86 0 130 3 rpsH Small ribosomal subunit protein uS8 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ25 1.75e-78 230 86 0 130 3 rpsH Small ribosomal subunit protein uS8 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N371 1.75e-78 230 86 0 130 3 rpsH Small ribosomal subunit protein uS8 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VLK2 5.73e-78 229 86 0 130 3 rpsH Small ribosomal subunit protein uS8 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UX28 8.98e-78 228 83 0 130 3 rpsH Small ribosomal subunit protein uS8 Histophilus somni (strain 2336)
Q0I148 8.98e-78 228 83 0 130 3 rpsH Small ribosomal subunit protein uS8 Histophilus somni (strain 129Pt)
P44377 1.39e-77 228 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHU5 1.39e-77 228 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Haemophilus influenzae (strain PittGG)
A5UDT3 1.39e-77 228 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Haemophilus influenzae (strain PittEE)
Q4QMA7 1.39e-77 228 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Haemophilus influenzae (strain 86-028NP)
B8F6Q7 1.81e-77 228 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Glaesserella parasuis serovar 5 (strain SH0165)
Q65QW9 3.46e-77 227 85 0 130 3 rpsH Small ribosomal subunit protein uS8 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKE7 6.06e-77 226 83 0 130 3 rpsH Small ribosomal subunit protein uS8 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4L7U4 4.92e-76 224 81 0 130 3 rpsH Small ribosomal subunit protein uS8 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5E8A0 2.24e-75 222 80 0 130 3 rpsH Small ribosomal subunit protein uS8 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FG23 6.63e-75 221 80 0 130 3 rpsH Small ribosomal subunit protein uS8 Aliivibrio fischeri (strain MJ11)
B6EPT9 9.63e-75 221 79 0 130 3 rpsH Small ribosomal subunit protein uS8 Aliivibrio salmonicida (strain LFI1238)
C3LRP4 3.88e-74 219 79 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ8 3.88e-74 219 79 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F566 3.88e-74 219 79 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A0KF35 1.16e-73 218 80 0 130 3 rpsH Small ribosomal subunit protein uS8 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87SZ9 1.31e-73 218 78 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SSZ2 1.37e-73 218 80 0 130 3 rpsH Small ribosomal subunit protein uS8 Aeromonas salmonicida (strain A449)
Q7MPH4 2.59e-73 217 78 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio vulnificus (strain YJ016)
Q8DE54 2.59e-73 217 78 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio vulnificus (strain CMCP6)
A7MWH3 3.84e-73 217 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio campbellii (strain ATCC BAA-1116)
Q15X59 1.1e-72 216 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A3Q996 1.14e-72 216 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8G1D4 1.78e-72 215 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella sediminis (strain HAW-EB3)
A1REC8 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella sp. (strain W3-18-1)
Q0I091 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella sp. (strain MR-7)
Q0HNS3 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella sp. (strain MR-4)
A0KRN8 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella sp. (strain ANA-3)
A4YBW9 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK55 2.53e-72 214 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3IJJ9 6.58e-72 214 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Pseudoalteromonas translucida (strain TAC 125)
B7VLE3 1.28e-71 213 77 0 130 3 rpsH Small ribosomal subunit protein uS8 Vibrio atlanticus (strain LGP32)
A9KWB6 5.29e-71 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella baltica (strain OS195)
A6WHU2 5.29e-71 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella baltica (strain OS185)
A3DA58 5.29e-71 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ1 5.29e-71 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella baltica (strain OS223)
Q6LVA2 5.97e-71 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Photobacterium profundum (strain SS9)
Q089P0 1.04e-70 211 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella frigidimarina (strain NCIMB 400)
B8CNE7 1.34e-70 210 75 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella piezotolerans (strain WP3 / JCM 13877)
B1KMW9 1.42e-70 210 75 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella woodyi (strain ATCC 51908 / MS32)
B4RT42 1.69e-70 210 76 0 130 3 rpsH Small ribosomal subunit protein uS8 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C4K7A4 1.83e-70 210 77 1 131 3 rpsH Small ribosomal subunit protein uS8 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0TLZ8 3.27e-70 209 74 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella halifaxensis (strain HAW-EB4)
A1S232 5.01e-70 209 78 2 132 3 rpsH Small ribosomal subunit protein uS8 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12SU5 9.36e-70 208 75 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8GYZ0 1.23e-69 208 73 0 130 3 rpsH Small ribosomal subunit protein uS8 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8D835 1.58e-69 207 74 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57577 1.58e-69 207 74 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9T3 1.58e-69 207 74 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1T0C8 1.69e-68 205 73 0 130 3 rpsH Small ribosomal subunit protein uS8 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5QXV9 3.57e-68 204 75 0 130 3 rpsH Small ribosomal subunit protein uS8 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1LTC4 4.59e-67 201 70 1 132 3 rpsH Small ribosomal subunit protein uS8 Baumannia cicadellinicola subsp. Homalodisca coagulata
P59030 1.13e-66 200 69 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q488Z9 1.83e-65 197 71 0 127 3 rpsH Small ribosomal subunit protein uS8 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1KRI7 1.69e-63 192 70 0 130 3 rpsH Small ribosomal subunit protein uS8 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66628 1.69e-63 192 70 0 130 3 rpsH Small ribosomal subunit protein uS8 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66627 1.69e-63 192 70 0 130 3 rpsH Small ribosomal subunit protein uS8 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3V2 1.69e-63 192 70 0 130 3 rpsH Small ribosomal subunit protein uS8 Neisseria meningitidis serogroup C (strain 053442)
Q5F5U1 1.69e-63 192 70 0 130 3 rpsH Small ribosomal subunit protein uS8 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2L273 1.23e-62 190 68 1 131 3 rpsH Small ribosomal subunit protein uS8 Bordetella avium (strain 197N)
A1TYL1 5.02e-62 189 68 0 129 3 rpsH Small ribosomal subunit protein uS8 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7NQG6 7.36e-62 188 68 1 131 3 rpsH Small ribosomal subunit protein uS8 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7VTB7 7.44e-62 188 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2E1 7.44e-62 188 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRA9 7.44e-62 188 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9IHT5 1.6e-61 187 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P59579 1.85e-61 187 66 0 130 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3J8S8 5.18e-61 186 67 0 130 3 rpsH Small ribosomal subunit protein uS8 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9HWE9 8.03e-61 186 65 0 129 1 rpsH Small ribosomal subunit protein uS8 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T66 8.03e-61 186 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V658 8.03e-61 186 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas aeruginosa (strain LESB58)
A6UZK2 8.03e-61 186 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas aeruginosa (strain PA7)
Q1H4M3 1.39e-60 185 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3SLN5 2.38e-60 184 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Thiobacillus denitrificans (strain ATCC 25259)
A4VHP4 2.71e-60 184 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Stutzerimonas stutzeri (strain A1501)
A2SLE3 3.45e-60 184 66 1 131 3 rpsH Small ribosomal subunit protein uS8 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A6T3J0 7.03e-60 183 66 1 131 3 rpsH Small ribosomal subunit protein uS8 Janthinobacterium sp. (strain Marseille)
B8GV44 7.19e-60 183 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q8D1Z8 1.23e-59 182 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Wigglesworthia glossinidia brevipalpis
C1DAT1 1.42e-59 182 67 1 131 3 rpsH Small ribosomal subunit protein uS8 Laribacter hongkongensis (strain HLHK9)
Q1R0G1 1.57e-59 182 66 0 129 3 rpsH Small ribosomal subunit protein uS8 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0ABG1 2.43e-59 182 66 1 130 3 rpsH Small ribosomal subunit protein uS8 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2SU41 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q25 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia pseudomallei (strain K96243)
A3NEG5 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia pseudomallei (strain 668)
Q3JMS7 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia pseudomallei (strain 1710b)
A3P099 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia pseudomallei (strain 1106a)
A1V889 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia mallei (strain SAVP1)
Q62GL9 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia mallei (strain ATCC 23344)
A2S7J0 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia mallei (strain NCTC 10229)
A3MRW8 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia mallei (strain NCTC 10247)
Q39KF3 2.68e-59 182 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4G9S4 4.38e-59 181 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Herminiimonas arsenicoxydans
A9BRW5 4.89e-59 181 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Delftia acidovorans (strain DSM 14801 / SPH-1)
A4XZ76 6.58e-59 181 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas mendocina (strain ymp)
Q2S926 9.35e-59 180 66 0 129 3 rpsH Small ribosomal subunit protein uS8 Hahella chejuensis (strain KCTC 2396)
A1KB13 1.31e-58 180 66 1 131 3 rpsH Small ribosomal subunit protein uS8 Azoarcus sp. (strain BH72)
Q21M44 1.46e-58 180 68 0 129 3 rpsH Small ribosomal subunit protein uS8 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C3K2W2 1.46e-58 180 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas fluorescens (strain SBW25)
B2JI51 1.5e-58 180 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C5BQ75 2.53e-58 179 66 0 129 3 rpsH Small ribosomal subunit protein uS8 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q4K547 3.15e-58 179 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZMQ8 3.76e-58 179 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas syringae pv. syringae (strain B728a)
Q889V7 3.76e-58 179 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D50 3.76e-58 179 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5P318 4.15e-58 179 65 1 131 3 rpsH Small ribosomal subunit protein uS8 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A9ADK7 5.05e-58 179 65 2 132 3 rpsH Small ribosomal subunit protein uS8 Burkholderia multivorans (strain ATCC 17616 / 249)
A9KD17 5.58e-58 178 65 1 129 3 rpsH Small ribosomal subunit protein uS8 Coxiella burnetii (strain Dugway 5J108-111)
Q21QN7 6.43e-58 178 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13TI4 8.09e-58 178 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Paraburkholderia xenovorans (strain LB400)
B2T737 8.09e-58 178 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4JAQ4 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRW2 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia orbicola (strain AU 1054)
B1JU36 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia orbicola (strain MC0-3)
Q0BJ32 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5D4 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N9 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia cenocepacia (strain HI2424)
B1YRP3 9.03e-58 178 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Burkholderia ambifaria (strain MC40-6)
B1XSR5 9.43e-58 178 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A1TJT1 9.43e-58 178 63 2 132 3 rpsH Small ribosomal subunit protein uS8 Paracidovorax citrulli (strain AAC00-1)
Q3K602 1.39e-57 177 64 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas fluorescens (strain Pf0-1)
Q31IW8 1.8e-57 177 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1IFV2 4.62e-57 176 63 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas entomophila (strain L48)
Q83ER2 4.73e-57 176 65 1 129 3 rpsH Small ribosomal subunit protein uS8 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY4 4.73e-57 176 65 1 129 3 rpsH Small ribosomal subunit protein uS8 Coxiella burnetii (strain RSA 331 / Henzerling II)
B1Y8C3 5.94e-57 176 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4SUX5 8.72e-57 175 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q6F7S6 9.95e-57 175 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B1JAJ8 1.23e-56 175 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas putida (strain W619)
A1W322 1.52e-56 175 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acidovorax sp. (strain JS42)
B9MBV1 1.52e-56 175 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acidovorax ebreus (strain TPSY)
Q88QM1 1.7e-56 174 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK81 1.7e-56 174 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas putida (strain GB-1)
A5VXR1 1.7e-56 174 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0V6V9 2.01e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acinetobacter baumannii (strain AYE)
A3M970 2.01e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQT2 2.01e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acinetobacter baumannii (strain SDF)
B7IA25 2.01e-56 174 63 1 131 1 rpsH Small ribosomal subunit protein uS8 Acinetobacter baumannii (strain AB0057)
B7GW16 2.01e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Acinetobacter baumannii (strain AB307-0294)
Q8XV26 2.44e-56 174 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q47J89 2.58e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Dechloromonas aromatica (strain RCB)
A5EXA4 2.73e-56 174 61 0 128 3 rpsH Small ribosomal subunit protein uS8 Dichelobacter nodosus (strain VCS1703A)
A1WKA2 3.01e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Verminephrobacter eiseniae (strain EF01-2)
A1VJ29 3.11e-56 174 63 1 131 3 rpsH Small ribosomal subunit protein uS8 Polaromonas naphthalenivorans (strain CJ2)
B3R7F4 3.36e-56 174 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46WF8 3.36e-56 174 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K633 3.36e-56 174 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7VQD4 7.47e-56 173 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Blochmanniella floridana
Q2YAY3 1.26e-55 172 64 1 131 3 rpsH Small ribosomal subunit protein uS8 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3PK51 1.34e-55 172 65 0 129 3 rpsH Small ribosomal subunit protein uS8 Cellvibrio japonicus (strain Ueda107)
B2UEK5 1.59e-55 172 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Ralstonia pickettii (strain 12J)
Q1LI51 2.97e-55 171 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q12G89 4.31e-55 171 62 1 131 3 rpsH Small ribosomal subunit protein uS8 Polaromonas sp. (strain JS666 / ATCC BAA-500)
C5CQ86 8.03e-54 168 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Variovorax paradoxus (strain S110)
Q82X77 8.86e-54 168 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q493J4 2.32e-53 167 61 1 131 3 rpsH Small ribosomal subunit protein uS8 Blochmanniella pennsylvanica (strain BPEN)
Q8PC38 8.73e-53 165 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU68 8.73e-53 165 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas campestris pv. campestris (strain B100)
Q4URF3 8.73e-53 165 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas campestris pv. campestris (strain 8004)
Q05HS7 1.02e-52 165 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ9 1.02e-52 165 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWW9 1.88e-52 164 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNR3 2.07e-52 164 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Xanthomonas axonopodis pv. citri (strain 306)
A5WCK4 9.83e-52 162 60 1 132 3 rpsH Small ribosomal subunit protein uS8 Psychrobacter sp. (strain PRwf-1)
A1WVA8 1.34e-51 162 60 1 130 3 rpsH Small ribosomal subunit protein uS8 Halorhodospira halophila (strain DSM 244 / SL1)
B4SKX7 1.79e-51 162 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Stenotrophomonas maltophilia (strain R551-3)
Q4FUE2 2.19e-51 162 58 1 132 3 rpsH Small ribosomal subunit protein uS8 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QDH2 3.04e-51 161 57 1 132 3 rpsH Small ribosomal subunit protein uS8 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B2FQJ8 3.9e-51 161 59 1 132 3 rpsH Small ribosomal subunit protein uS8 Stenotrophomonas maltophilia (strain K279a)
B5ELZ3 5.2e-51 160 59 1 131 3 rpsH Small ribosomal subunit protein uS8 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J481 5.2e-51 160 59 1 131 3 rpsH Small ribosomal subunit protein uS8 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0AII2 1.19e-50 160 60 1 131 3 rpsH Small ribosomal subunit protein uS8 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A6W378 3.86e-50 159 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Marinomonas sp. (strain MWYL1)
Q0VSI9 1.41e-49 157 55 0 130 3 rpsH Small ribosomal subunit protein uS8 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6XYX4 1.29e-48 155 55 0 127 3 rpsH Small ribosomal subunit protein uS8 Spiroplasma kunkelii
B8D0D8 1.65e-48 154 54 2 131 3 rpsH Small ribosomal subunit protein uS8 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q605C6 2.47e-48 154 57 1 130 3 rpsH Small ribosomal subunit protein uS8 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q057B8 7.81e-48 152 62 0 129 3 rpsH Small ribosomal subunit protein uS8 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0U0X5 3.68e-47 151 56 1 132 3 rpsH Small ribosomal subunit protein uS8 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B0U5L3 1.14e-46 150 56 2 132 3 rpsH Small ribosomal subunit protein uS8 Xylella fastidiosa (strain M12)
Q87E68 7.39e-46 148 54 1 132 3 rpsH Small ribosomal subunit protein uS8 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8I3 7.39e-46 148 54 1 132 3 rpsH Small ribosomal subunit protein uS8 Xylella fastidiosa (strain M23)
Q0BNR3 8.06e-46 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5F6 8.06e-46 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T9 8.06e-46 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q97EJ2 8.33e-46 147 53 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A4IZS0 1.11e-45 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHV4 1.11e-45 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SDX1 1.11e-45 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JA6 1.11e-45 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q4J7 1.72e-45 147 57 2 133 3 rpsH Small ribosomal subunit protein uS8 Francisella tularensis subsp. novicida (strain U112)
Q9PE62 2.13e-45 147 56 2 132 3 rpsH Small ribosomal subunit protein uS8 Xylella fastidiosa (strain 9a5c)
A1AVL4 2.6e-45 146 53 1 130 3 rpsH Small ribosomal subunit protein uS8 Ruthia magnifica subsp. Calyptogena magnifica
A9NEE7 5.92e-45 145 53 1 130 3 rpsH Small ribosomal subunit protein uS8 Acholeplasma laidlawii (strain PG-8A)
A5CXL8 6.32e-45 145 53 1 130 3 rpsH Small ribosomal subunit protein uS8 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q5WZJ8 8.68e-45 145 56 3 133 3 rpsH Small ribosomal subunit protein uS8 Legionella pneumophila (strain Lens)
Q5ZYM9 8.68e-45 145 56 3 133 3 rpsH Small ribosomal subunit protein uS8 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6NJ88 9.66e-45 145 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B2A4F3 1.13e-44 145 53 2 131 3 rpsH Small ribosomal subunit protein uS8 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B1VEW9 1.17e-44 145 52 2 134 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q4FLN2 1.34e-44 144 52 1 130 3 rpsH Small ribosomal subunit protein uS8 Pelagibacter ubique (strain HTCC1062)
A6LPS5 3.44e-44 144 54 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A0L5Y7 3.88e-44 143 55 1 131 3 rpsH Small ribosomal subunit protein uS8 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5X845 4.89e-44 143 55 3 133 3 rpsH Small ribosomal subunit protein uS8 Legionella pneumophila (strain Paris)
Q318J7 6.4e-44 143 53 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9312)
A9KJI0 1.04e-43 142 51 3 133 3 rpsH Small ribosomal subunit protein uS8 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A3PF34 1.05e-43 142 53 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9301)
Q3A9T0 1.36e-43 142 53 2 131 3 rpsH Small ribosomal subunit protein uS8 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A2BTC4 2.02e-43 142 53 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain AS9601)
A0PXW0 2.09e-43 141 50 1 130 3 rpsH Small ribosomal subunit protein uS8 Clostridium novyi (strain NT)
A4J125 2.38e-43 141 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A1ALV5 2.6e-43 141 53 2 131 3 rpsH Small ribosomal subunit protein uS8 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B2TII9 2.93e-43 141 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYC4 2.93e-43 141 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Alaska E43 / Type E3)
B1KSL1 3.17e-43 141 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ60 3.17e-43 141 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FMT7 3.17e-43 141 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Kyoto / Type A2)
A5I7J2 3.17e-43 141 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ55 3.17e-43 141 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain ATCC 19397 / Type A)
Q8R7W8 4.44e-43 140 54 2 131 3 rpsH Small ribosomal subunit protein uS8 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O24702 5e-43 140 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L20 5e-43 140 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q890P9 5.12e-43 140 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium tetani (strain Massachusetts / E88)
Q7UZV7 5.28e-43 140 52 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q8FS55 5.47e-43 140 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q250L8 6.96e-43 140 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Desulfitobacterium hafniense (strain Y51)
B8G1Y0 6.96e-43 140 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q4JT83 8.02e-43 140 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium jeikeium (strain K411)
A8G748 9.02e-43 140 52 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9215)
A5D5G8 9.66e-43 140 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C3KVN7 1.2e-42 140 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain 657 / Type Ba4)
B8I7Z3 1.27e-42 139 53 1 130 3 rpsH Small ribosomal subunit protein uS8 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q39XZ2 1.45e-42 139 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8DML9 1.51e-42 139 49 2 132 3 rpsH Small ribosomal subunit protein uS8 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B1IGE0 1.51e-42 139 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium botulinum (strain Okra / Type B1)
A5IHQ0 1.63e-42 139 54 3 131 3 rpsH Small ribosomal subunit protein uS8 Legionella pneumophila (strain Corby)
A1SNK4 1.71e-42 139 48 2 134 3 rpsH Small ribosomal subunit protein uS8 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q67JV7 1.9e-42 139 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q0AUJ4 2.56e-42 139 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B0K5Q7 2.61e-42 139 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Thermoanaerobacter sp. (strain X514)
B0KCL4 2.61e-42 139 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
P04446 2.81e-42 139 51 2 126 3 rpsH Small ribosomal subunit protein uS8 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q1XDI7 4.76e-42 138 51 3 133 3 rps8 Small ribosomal subunit protein uS8c Neopyropia yezoensis
C4LL12 5.62e-42 138 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q8NSX8 6.34e-42 138 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBL0 6.34e-42 138 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Corynebacterium glutamicum (strain R)
Q47LK7 7.14e-42 137 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Thermobifida fusca (strain YX)
A8MLF4 7.14e-42 137 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Alkaliphilus oremlandii (strain OhILAs)
B8G6R1 8.04e-42 137 48 2 132 3 rpsH Small ribosomal subunit protein uS8 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A1B041 8.15e-42 137 53 2 132 3 rpsH Small ribosomal subunit protein uS8 Paracoccus denitrificans (strain Pd 1222)
Q6A6P0 9.12e-42 137 47 2 134 1 rpsH Small ribosomal subunit protein uS8 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q2JQN3 9.34e-42 137 51 3 130 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain JA-3-3Ab)
B0TC70 9.6e-42 137 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A6MW14 9.81e-42 137 52 3 131 3 rps8 Small ribosomal subunit protein uS8c Rhodomonas salina
B6IRS0 1.11e-41 137 50 2 132 3 rpsH Small ribosomal subunit protein uS8 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6MSN9 1.13e-41 137 50 2 126 3 rpsH Small ribosomal subunit protein uS8 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A2BYS3 1.73e-41 137 51 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9515)
Q749A1 1.93e-41 137 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B9MKG7 2.09e-41 136 52 2 131 3 rpsH Small ribosomal subunit protein uS8 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q6F1Y0 2.62e-41 136 49 0 125 3 rpsH Small ribosomal subunit protein uS8 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
A6TWG8 2.68e-41 136 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Alkaliphilus metalliredigens (strain QYMF)
B0JHZ0 3.12e-41 136 49 3 133 3 rpsH Small ribosomal subunit protein uS8 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q3AW80 3.92e-41 136 51 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain CC9902)
P73307 3.97e-41 136 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0SQF8 3.98e-41 136 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium perfringens (strain SM101 / Type A)
Q8XHT7 3.98e-41 136 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium perfringens (strain 13 / Type A)
Q0TMR0 3.98e-41 136 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q16AD0 4.13e-41 135 51 2 129 3 rpsH Small ribosomal subunit protein uS8 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q110C0 5.63e-41 135 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Trichodesmium erythraeum (strain IMS101)
Q7U4I7 6.01e-41 135 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Parasynechococcus marenigrum (strain WH8102)
C5CGI8 6.06e-41 135 53 2 132 3 rpsH Small ribosomal subunit protein uS8 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B9M6G4 6.09e-41 135 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q3A6N3 7.33e-41 135 54 2 131 3 rpsH Small ribosomal subunit protein uS8 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3AMP3 8.16e-41 135 51 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain CC9605)
A0LIK4 8.18e-41 135 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B5YG33 8.57e-41 135 47 2 129 3 rpsH Small ribosomal subunit protein uS8 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A4XLR6 8.93e-41 135 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q6AD08 1.16e-40 134 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Leifsonia xyli subsp. xyli (strain CTCB07)
A5GAV6 1.16e-40 134 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Geotalea uraniireducens (strain Rf4)
P51301 1.24e-40 134 50 3 133 3 rps8 Small ribosomal subunit protein uS8c Porphyra purpurea
Q7V532 1.46e-40 134 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9313)
Q0ID18 1.72e-40 134 49 2 132 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain CC9311)
A2C4Y6 1.85e-40 134 50 3 134 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain NATL1A)
B2IK76 1.96e-40 134 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8HMR7 2.16e-40 134 47 2 132 3 rpsH Small ribosomal subunit protein uS8 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q0ANR4 2.19e-40 134 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Maricaulis maris (strain MCS10)
A7NR49 2.39e-40 134 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A9IW08 2.66e-40 134 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5USH5 2.71e-40 134 49 2 129 3 rpsH Small ribosomal subunit protein uS8 Roseiflexus sp. (strain RS-1)
A5GVX3 2.72e-40 134 49 2 132 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain RCC307)
A5N4R1 2.72e-40 134 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYC3 2.72e-40 134 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Clostridium kluyveri (strain NBRC 12016)
B8ELE9 3e-40 134 49 1 131 3 rpsH Small ribosomal subunit protein uS8 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B7KI00 4.54e-40 133 48 3 133 3 rpsH Small ribosomal subunit protein uS8 Gloeothece citriformis (strain PCC 7424)
Q3MFA8 4.79e-40 133 49 3 133 3 rpsH Small ribosomal subunit protein uS8 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B5ZYU9 6.25e-40 133 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MIC7 6.25e-40 133 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7NEG6 6.37e-40 133 50 2 132 3 rpsH Small ribosomal subunit protein uS8 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2K9K2 6.53e-40 133 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWT5 6.53e-40 133 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium etli (strain CIAT 652)
Q2GL45 7.34e-40 132 51 2 130 3 rpsH Small ribosomal subunit protein uS8 Anaplasma phagocytophilum (strain HZ)
Q46IS2 7.5e-40 132 50 3 134 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain NATL2A)
A6U873 7.86e-40 132 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Sinorhizobium medicae (strain WSM419)
A5CUA0 8.21e-40 132 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A9BCN4 8.28e-40 132 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9211)
O46907 8.3e-40 132 50 2 129 3 rps8 Small ribosomal subunit protein uS8c Guillardia theta
A5GIT2 9.44e-40 132 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain WH7803)
C3MAZ4 9.67e-40 132 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A2CC41 1.02e-39 132 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain MIT 9303)
Q7V9X5 1.08e-39 132 50 3 133 3 rpsH Small ribosomal subunit protein uS8 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A8AZL1 1.12e-39 132 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q92QF6 1.12e-39 132 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium meliloti (strain 1021)
B3E7U9 1.24e-39 132 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9JDU2 1.47e-39 132 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2JIL4 1.51e-39 132 48 3 132 3 rpsH Small ribosomal subunit protein uS8 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q1AU43 1.56e-39 132 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P33106 1.61e-39 132 47 3 132 3 rpsH Small ribosomal subunit protein uS8 Micrococcus luteus
Q8YPJ2 1.74e-39 132 48 3 133 3 rpsH Small ribosomal subunit protein uS8 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DS27 1.76e-39 132 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B0RZS3 1.83e-39 132 49 2 129 3 rpsH Small ribosomal subunit protein uS8 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A3CK77 1.93e-39 131 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus sanguinis (strain SK36)
Q73S95 2.22e-39 131 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QKZ8 2.22e-39 131 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium avium (strain 104)
A9WSU4 2.42e-39 131 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B0C1E6 2.69e-39 131 46 3 133 3 rpsH Small ribosomal subunit protein uS8 Acaryochloris marina (strain MBIC 11017)
Q98N43 2.7e-39 131 49 2 132 3 rpsH Small ribosomal subunit protein uS8 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8RIH0 3.25e-39 131 48 2 132 3 rpsH Small ribosomal subunit protein uS8 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B9JVQ1 3.36e-39 131 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1GK15 3.65e-39 130 48 1 129 3 rpsH Small ribosomal subunit protein uS8 Ruegeria sp. (strain TM1040)
C5CC49 3.96e-39 130 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q2RFR1 3.98e-39 130 48 2 129 3 rpsH Small ribosomal subunit protein uS8 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P49399 4e-39 130 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WH27 4.05e-39 130 48 2 131 1 rpsH Small ribosomal subunit protein uS8 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH26 4.05e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U0A4 4.05e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL52 4.05e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGJ9 4.05e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66626 4.05e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2G8W6 4.58e-39 130 48 1 130 3 rpsH Small ribosomal subunit protein uS8 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A1VEA2 5.29e-39 130 50 2 128 3 rpsH Small ribosomal subunit protein uS8 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CG6 5.29e-39 130 50 2 128 3 rpsH Small ribosomal subunit protein uS8 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6FZD6 5.94e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Bartonella quintana (strain Toulouse)
B9DM33 7.07e-39 130 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Staphylococcus carnosus (strain TM300)
C6E4P3 7.8e-39 130 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Geobacter sp. (strain M21)
B5EFR4 7.8e-39 130 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A0QSG3 8.33e-39 130 48 2 131 1 rpsH Small ribosomal subunit protein uS8 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1BD91 8.42e-39 130 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium sp. (strain MCS)
A1UBQ2 8.42e-39 130 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium sp. (strain KMS)
A3PVD9 8.42e-39 130 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium sp. (strain JLS)
B1I1K2 8.92e-39 130 47 2 129 3 rpsH Small ribosomal subunit protein uS8 Desulforudis audaxviator (strain MP104C)
A4XBN2 1.07e-38 130 49 3 137 3 rpsH Small ribosomal subunit protein uS8 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B8DW27 1.13e-38 129 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Bifidobacterium animalis subsp. lactis (strain AD011)
Q28UU0 1.21e-38 129 47 1 129 3 rpsH Small ribosomal subunit protein uS8 Jannaschia sp. (strain CCS1)
B7GNC6 1.28e-38 129 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G404 1.28e-38 129 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Bifidobacterium longum (strain NCC 2705)
B1XJS6 1.33e-38 129 47 2 132 3 rpsH Small ribosomal subunit protein uS8 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q9Z9K0 1.36e-38 129 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4FPL1 1.49e-38 129 49 2 130 3 rpsH Small ribosomal subunit protein uS8 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B4UBB3 1.6e-38 129 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Anaeromyxobacter sp. (strain K)
B8J874 1.6e-38 129 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A0JZ71 1.69e-38 129 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Arthrobacter sp. (strain FB24)
A1A083 1.75e-38 129 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q6G2X9 1.81e-38 129 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A8M515 1.81e-38 129 49 3 137 3 rpsH Small ribosomal subunit protein uS8 Salinispora arenicola (strain CNS-205)
Q3Z967 2.11e-38 129 50 2 129 3 rpsH Small ribosomal subunit protein uS8 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A4WVJ4 2.28e-38 129 47 1 131 3 rpsH Small ribosomal subunit protein uS8 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A6W5V2 2.33e-38 129 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q6KI41 2.59e-38 129 46 1 128 3 rpsH Small ribosomal subunit protein uS8 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B6JEX9 2.59e-38 129 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B5E6G9 2.62e-38 129 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae serotype 19F (strain G54)
Q5FTZ7 2.65e-38 129 47 1 131 3 rpsH Small ribosomal subunit protein uS8 Gluconobacter oxydans (strain 621H)
A9VP91 2.68e-38 129 51 2 131 3 rpsH Small ribosomal subunit protein uS8 Bacillus mycoides (strain KBAB4)
Q8E2C0 3.16e-38 128 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
A0PM79 3.3e-38 128 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium ulcerans (strain Agy99)
B2HCT5 3.3e-38 128 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q3ZZL0 3.49e-38 128 49 2 129 3 rpsH Small ribosomal subunit protein uS8 Dehalococcoides mccartyi (strain CBDB1)
A5FRX5 3.49e-38 128 49 2 129 3 rpsH Small ribosomal subunit protein uS8 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3J5Q8 3.8e-38 128 46 1 131 3 rpsH Small ribosomal subunit protein uS8 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGM5 3.8e-38 128 46 1 131 3 rpsH Small ribosomal subunit protein uS8 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q2IJ72 4.29e-38 128 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8E7S7 4.48e-38 128 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3V5 4.48e-38 128 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C1CPA2 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIB1 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain P1031)
C1CC20 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain JJA)
P66633 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS54 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain CGSP14)
P66632 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKP4 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8L2 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAM6 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae (strain 70585)
Q04MM2 4.53e-38 128 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q6YR08 4.56e-38 128 48 2 130 3 rpsH Small ribosomal subunit protein uS8 Onion yellows phytoplasma (strain OY-M)
Q2NIW8 4.66e-38 128 48 2 130 3 rpsH Small ribosomal subunit protein uS8 Aster yellows witches'-broom phytoplasma (strain AYWB)
A4YSK6 4.94e-38 128 47 1 131 3 rpsH Small ribosomal subunit protein uS8 Bradyrhizobium sp. (strain ORS 278)
Q5WLP8 5e-38 128 49 2 131 3 rpsH Small ribosomal subunit protein uS8 Shouchella clausii (strain KSM-K16)
B1YGW4 5.05e-38 128 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A5ELL3 5.11e-38 128 47 1 131 3 rpsH Small ribosomal subunit protein uS8 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8IAQ0 5.16e-38 128 46 1 131 3 rpsH Small ribosomal subunit protein uS8 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1QN16 5.28e-38 128 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4TEC3 5.63e-38 128 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycolicibacterium gilvum (strain PYR-GCK)
B2GJ06 5.82e-38 128 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q2RQX4 5.95e-38 128 47 2 132 3 rpsH Small ribosomal subunit protein uS8 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C0ZIJ4 6.22e-38 128 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5LW44 6.32e-38 127 46 1 129 3 rpsH Small ribosomal subunit protein uS8 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A3DJI6 6.42e-38 127 50 2 131 3 rpsH Small ribosomal subunit protein uS8 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
P56209 6.44e-38 127 48 1 130 1 rpsH Small ribosomal subunit protein uS8 Geobacillus stearothermophilus
Q82DN2 6.78e-38 127 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1T4S0 6.78e-38 127 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
C0ZW40 7.4e-38 127 47 2 131 3 rpsH Small ribosomal subunit protein uS8 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A9H3M1 8.08e-38 127 46 2 132 3 rpsH Small ribosomal subunit protein uS8 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q4AAF4 8.37e-38 127 44 0 127 3 rpsH Small ribosomal subunit protein uS8 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A8I5 8.37e-38 127 44 0 127 3 rpsH Small ribosomal subunit protein uS8 Mesomycoplasma hyopneumoniae (strain 7448)
Q601K0 8.37e-38 127 44 0 127 3 rpsH Small ribosomal subunit protein uS8 Mesomycoplasma hyopneumoniae (strain 232)
B9LJE6 8.99e-38 127 45 2 132 3 rpsH Small ribosomal subunit protein uS8 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH80 8.99e-38 127 45 2 132 3 rpsH Small ribosomal subunit protein uS8 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B9E9K5 9.11e-38 127 46 2 131 3 rpsH Small ribosomal subunit protein uS8 Macrococcus caseolyticus (strain JCSC5402)
A0T0Y6 9.21e-38 127 49 3 129 3 rps8 Small ribosomal subunit protein uS8c Thalassiosira pseudonana
B1MW01 9.84e-38 127 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Leuconostoc citreum (strain KM20)
Q03ZN2 1.01e-37 127 48 2 131 3 rpsH Small ribosomal subunit protein uS8 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q03IG5 1.17e-37 127 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2C7 1.17e-37 127 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXS5 1.17e-37 127 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Streptococcus thermophilus (strain CNRZ 1066)
Q0RRQ7 1.25e-37 127 44 2 135 3 rpsH Small ribosomal subunit protein uS8 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B3QBW6 1.28e-37 127 48 1 131 3 rpsH Small ribosomal subunit protein uS8 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U7 1.28e-37 127 48 1 131 1 rpsH Small ribosomal subunit protein uS8 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A9FGG6 1.31e-37 127 46 2 129 3 rpsH Small ribosomal subunit protein uS8 Sorangium cellulosum (strain So ce56)
B8HCZ3 1.34e-37 127 45 2 131 3 rpsH Small ribosomal subunit protein uS8 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18525
Feature type CDS
Gene -
Product Small ribosomal subunit protein uS8
Location 16295 - 16687 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession ZDB_706
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2418
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00410 Ribosomal protein S8

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0096 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S8

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02994 small subunit ribosomal protein S8 Ribosome -

Protein Sequence

MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGYIEDFKIEGDIKPELELTLKYFQGKAVVESIQRVSRPSLRIYKRKDELPQVMAGLGIAVVSTSKGVMTDRAARQAGLGGEILCYVA

Flanking regions ( +/- flanking 50bp)

GAAAGCTAGCTGGTAATTGTCACCATATTGAATCACGGGAGTAAAGACAGATGAGCATGCAAGATCCCATCGCGGATATGCTGACCCGTATCCGTAACGGTCAGGCCGCGAACAAAGTTGCGGTCACCATGCCTTCCTCCAAGCTGAAAGTGGCAATTGCCAACGTGCTGAAGGAAGAAGGTTATATTGAAGATTTTAAAATCGAAGGCGACATCAAGCCAGAACTGGAACTGACTCTTAAGTATTTCCAGGGTAAGGCTGTTGTAGAAAGCATCCAGCGCGTAAGCCGCCCAAGTCTGCGTATTTATAAGCGCAAAGACGAACTGCCACAAGTTATGGCAGGTCTGGGTATCGCAGTTGTTTCTACATCTAAAGGTGTAATGACTGATCGTGCAGCTCGCCAGGCTGGTCTTGGTGGCGAGATTCTCTGCTACGTAGCATAATTCGGGAGGAAAGAATGTCTCGTGTGGCAAAAGCACCCGTCGTCATTCCT