Homologs in group_2251

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17355 FBDBKF_17355 100.0 Morganella morganii S1 ispA (2E,6E)-farnesyl diphosphate synthase
EHELCC_17250 EHELCC_17250 100.0 Morganella morganii S2 ispA (2E,6E)-farnesyl diphosphate synthase
NLDBIP_17945 NLDBIP_17945 100.0 Morganella morganii S4 ispA (2E,6E)-farnesyl diphosphate synthase
LHKJJB_17865 LHKJJB_17865 100.0 Morganella morganii S3 ispA (2E,6E)-farnesyl diphosphate synthase
F4V73_RS16530 F4V73_RS16530 91.8 Morganella psychrotolerans ispA (2E,6E)-farnesyl diphosphate synthase
PMI_RS00455 PMI_RS00455 68.9 Proteus mirabilis HI4320 ispA (2E,6E)-farnesyl diphosphate synthase

Distribution of the homologs in the orthogroup group_2251

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2251

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22939 5.6e-123 357 62 0 297 1 ispA Farnesyl diphosphate synthase Escherichia coli (strain K12)
P45204 6.21e-88 267 52 4 298 3 ispA Farnesyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9A0 1.91e-86 264 46 3 285 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57537 2.96e-79 245 43 2 271 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B1XJV9 1.96e-67 215 44 6 295 1 crtE Geranylgeranyl pyrophosphate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q08291 9.72e-64 206 46 3 268 1 None Farnesyl diphosphate synthase Geobacillus stearothermophilus
O66126 5.71e-61 198 41 5 300 3 fps Farnesyl diphosphate synthase Micrococcus luteus
P48368 2.89e-60 197 40 5 301 3 crtE Geranylgeranyl diphosphate synthase Cyanophora paradoxa
Q45220 6.38e-60 197 44 3 296 3 fppS Probable farnesyl diphosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P55539 1.61e-59 196 45 3 281 3 NGR_a02750 Probable farnesyl diphosphate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P80042 5.04e-59 196 40 6 304 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Capsicum annuum
Q43133 2.35e-57 191 42 5 270 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic/chromoplastic Sinapis alba
Q42698 3.05e-57 191 41 5 282 3 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Catharanthus roseus
P34802 1.43e-56 189 42 4 270 1 GGPPS1 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic Arabidopsis thaliana
Q9SLG2 8.23e-56 187 38 5 299 1 GGPP4 Geranylgeranyl pyrophosphate synthase 4 Arabidopsis thaliana
P54383 9.85e-56 185 42 3 271 3 ispA Farnesyl diphosphate synthase Bacillus subtilis (strain 168)
V5TF61 1.12e-55 186 42 8 304 1 ambP2 Dimethylallyltranstransferase Fischerella ambigua (strain UTEX 1903)
Q94ID7 5.2e-54 183 39 8 300 1 GGPS Geranylgeranyl pyrophosphate synthase, chloroplastic Hevea brasiliensis
Q9ZU77 5.28e-54 182 42 8 273 2 At2g18620 Geranylgeranyl pyrophosphate synthase 7, chloroplastic Arabidopsis thaliana
Q9LJY2 7.16e-53 179 37 6 303 1 At3g20160 Geranylgeranyl pyrophosphate synthase 10, mitochondrial Arabidopsis thaliana
O04046 6.34e-51 175 39 6 269 1 GGPPS2 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 2 Arabidopsis thaliana
A0A0U3BRC5 2.22e-50 173 42 4 269 1 GFDPS Geranylfarnesyl diphosphate synthase, chloroplastic Leucosceptrum canum
Q9LRR0 7.41e-50 172 40 4 299 5 At3g14510 Putative geranylgeranyl pyrophosphate synthase 8, chloroplastic Arabidopsis thaliana
O22043 4.77e-47 164 38 3 271 1 GGPP6 Geranylgeranyl pyrophosphate synthase 6, mitochondrial Arabidopsis thaliana
Q9LUE1 7.69e-46 161 41 4 272 1 GGPPS9 Geranylgeranyl pyrophosphate synthase 9, chloroplastic Arabidopsis thaliana
Q9LUD9 1.58e-45 160 41 4 272 1 GGPP3 Geranylgeranyl pyrophosphate synthase 3, chloroplastic Arabidopsis thaliana
Q9LIA0 2.95e-44 157 45 2 240 2 At3g29430 Geranylgeranyl pyrophosphate synthase 11, chloroplastic Arabidopsis thaliana
Q9LHR4 1.08e-43 155 38 4 300 2 At3g32040 Geranylgeranyl pyrophosphate synthase 12, chloroplastic Arabidopsis thaliana
O66952 4.28e-43 151 35 6 267 3 ispA Farnesyl diphosphate synthase Aquifex aeolicus (strain VF5)
Q58270 2.49e-40 146 38 5 252 3 idsA Short chain isoprenyl diphosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P17060 1.29e-34 130 35 7 245 3 crtE Geranylgeranyl diphosphate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P21684 1.95e-34 130 36 8 275 3 crtE Geranylgeranyl diphosphate synthase Pantoea ananas
P54976 2.96e-34 129 34 7 270 3 crtE Geranylgeranyl diphosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q53479 2.04e-33 128 40 5 221 1 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
A0A0A7GEY4 1.23e-31 123 37 7 220 1 GACE_1337 Geranylgeranyl pyrophosphate synthase Geoglobus acetivorans
O26156 1.94e-30 120 39 5 221 3 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q39108 2.45e-30 119 38 6 227 1 GGR Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic Arabidopsis thaliana
P95999 3.64e-28 114 33 6 228 3 gds Geranylgeranyl diphosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P39464 4.02e-28 114 31 8 287 1 gds Geranylgeranyl diphosphate synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q8PW34 2.42e-27 111 33 8 288 3 MM_1767 Geranylgeranyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9UWR6 2.24e-25 106 36 8 249 1 fgs Geranylfarnesyl diphosphate synthase Aeropyrum pernix
P22873 1.19e-24 103 36 6 230 1 crtE Geranylgeranyl diphosphate synthase Pseudescherichia vulneris
P9WKH1 2.43e-24 104 36 5 209 1 Rv3398c (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKH0 2.43e-24 104 36 5 209 3 MT3506 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5H9 2.43e-24 104 36 5 209 3 BQ2027_MB3431C (2E,6E)-farnesyl diphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P44916 6.99e-23 99 29 5 256 1 ispB Octaprenyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O24743 7.68e-23 99 32 8 244 1 sdsA All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) Rhodobacter capsulatus
Q0INZ4 8.66e-23 100 36 10 234 3 SPS3 Probable solanesyl-diphosphate synthase 3, chloroplastic Oryza sativa subsp. japonica
Q1XDL8 3.28e-22 97 30 8 296 3 preA Prenyl transferase Neopyropia yezoensis
Q75HZ9 1.02e-21 97 34 9 227 1 SPS2 Solanesyl-diphosphate synthase 2, chloroplastic Oryza sativa subsp. japonica
P55785 2.28e-21 95 32 6 223 3 hepT Heptaprenyl diphosphate synthase component 2 Geobacillus stearothermophilus
O66129 5.78e-21 94 28 8 266 1 hexs-b Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) Micrococcus luteus
Q8S948 1.01e-20 94 34 9 227 1 SPS1 Solanesyl diphosphate synthase 1, chloroplastic Arabidopsis thaliana
O50410 1.87e-20 93 35 7 207 1 idsB Geranylgeranyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P31114 1.76e-19 90 31 8 237 1 hepT Heptaprenyl diphosphate synthase component 2 Bacillus subtilis (strain 168)
Q3IPL1 2.21e-19 90 32 6 228 1 idsA3 Geranylfarnesyl diphosphate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q76FS5 3.95e-19 90 32 7 221 1 SPS2 Solanesyl diphosphate synthase 2, chloroplastic Arabidopsis thaliana
P51268 1.83e-18 87 30 8 262 3 preA Prenyl transferase Porphyra purpurea
P0AD58 1.46e-17 84 30 6 217 3 ispB Octaprenyl diphosphate synthase Shigella flexneri
P0AD57 1.46e-17 84 30 6 217 1 ispB Octaprenyl diphosphate synthase Escherichia coli (strain K12)
Q8PYS1 4.33e-16 80 29 9 222 1 MM_0789 Geranylfarnesyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P72580 1.76e-15 79 32 8 221 3 preA Prenyl transferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HZ00 2.14e-15 79 32 5 189 1 SPS3 Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial Arabidopsis thaliana
Q54VJ9 2.63e-15 79 29 5 217 3 coq1 Decaprenyl-diphosphate synthase Dictyostelium discoideum
O43091 3.89e-15 78 32 5 189 1 dps1 Decaprenyl-diphosphate synthase subunit 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6CBH3 1.99e-14 76 32 6 195 3 COQ1 Probable hexaprenyl pyrophosphate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
P31171 3.05e-14 75 32 8 222 3 preA Prenyl transferase Cyanophora paradoxa
H1VQB1 1.4e-13 73 27 7 231 1 dpchD Geranylgeranyl pyrophosphate synthase dpchD Colletotrichum higginsianum (strain IMI 349063)
Q7S565 4.74e-13 72 33 7 197 3 NCU02305 Probable hexaprenyl pyrophosphate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q33DR2 1.16e-12 71 30 9 223 1 Pdss1 All trans-polyprenyl-diphosphate synthase PDSS1 Mus musculus
Q653T6 1.5e-12 71 30 6 186 1 SPS1 Solanesyl-diphosphate synthase 1, mitochondrial Oryza sativa subsp. japonica
M2U578 1.77e-12 71 28 7 222 1 tpcA Preterpestacin I synthase tpcA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
Q9TLS1 1.91e-12 70 27 7 219 3 preA Prenyl transferase Cyanidium caldarium
B2DBE9 1.93e-12 70 26 6 246 1 GGS-D Geranylgeranyl pyrophosphate synthase D Phomopsis amygdali
E9F5E9 2.07e-12 70 25 7 221 1 subD Geranylgeranyl pyrophosphate synthase subD Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
P9WEW8 2.3e-12 70 27 7 225 1 dpmpD Geranylgeranyl pyrophosphate synthase dpmpD Macrophomina phaseolina (strain MS6)
O53507 2.85e-12 69 28 7 229 1 idsA2 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O06428 2.95e-12 69 32 8 218 1 grcC1 Nonaprenyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
F9XLC1 4.21e-12 69 27 7 234 3 GGS3 Geranylgeranyl pyrophosphate synthase 3 Zymoseptoria tritici (strain CBS 115943 / IPO323)
Q5T2R2 5.76e-12 69 28 9 250 1 PDSS1 All trans-polyprenyl-diphosphate synthase PDSS1 Homo sapiens
Q758K0 5.81e-12 68 27 7 240 3 BTS1 Geranylgeranyl pyrophosphate synthase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
N4V6D4 9.46e-12 68 28 7 237 1 btcA Sesterterpene synthase btcA Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
S0E627 1.15e-11 68 29 7 216 2 GGS2 Geranylgeranyl pyrophosphate synthase 2 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q12051 1.27e-11 67 22 7 258 1 BTS1 Geranylgeranyl pyrophosphate synthase BTS1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A2Z6AQX6 1.37e-11 68 26 8 266 1 PvPS Preasperterpenoid A synthase PvPS Talaromyces verruculosus
P9WEX9 1.79e-11 67 25 7 219 1 dpmaD Geranylgeranyl pyrophosphate synthase dpmaD Metarhizium anisopliae
A0A140JWS2 5.8e-11 65 27 5 233 3 ptmG Geranylgeranyl pyrophosphate synthase penG Penicillium simplicissimum
A0A0E3D8P4 5.89e-11 65 26 5 233 3 penG Geranylgeranyl pyrophosphate synthase penG Penicillium crustosum
A0A8H4CUY8 1.36e-10 65 28 9 238 1 GCG54_00000376 Colleterpenol synthase Colletotrichum gloeosporioides
I1RL14 1.72e-10 64 26 7 219 1 dpfgD Geranylgeranyl pyrophosphate synthase dpfgD Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A169T193 3.59e-10 64 27 7 222 1 EvAS Astellifadiene synthase Emericella variicolor
P9WEX3 6.87e-10 62 24 6 225 1 dpasD Geranylgeranyl pyrophosphate synthase dpasD Apiospora sacchari
P18900 9.55e-10 62 28 8 223 1 COQ1 Hexaprenyl pyrophosphate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A1V0QSA8 1.04e-09 62 24 8 250 2 eriE Geranylgeranyl pyrophosphate synthase AN1592 Hericium erinaceus
J7FIX8 2.26e-09 61 27 11 229 3 idtG Geranylgeranyl pyrophosphate synthase idtG Claviceps paspali
A0A858E7G0 2.47e-09 61 25 8 236 1 GGDPS Geranylgeranyl pyrophosphate synthase Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
P9WER6 2.77e-09 61 26 5 234 1 None Fusoxypene synthase Fusarium oxysporum
A0A1Y1C7Q5 3.93e-09 61 26 5 216 3 EvQS Quiannulatene synthase Emericella variicolor
A0A2Z6FZ31 2.51e-08 58 23 4 224 1 btcA Sesterterpene synthase btcA Neocamarosporium betae
Q92236 3.45e-08 57 25 8 227 3 GGS Geranylgeranyl pyrophosphate synthase Gibberella fujikuroi
A0A858E7J4 3.81e-08 57 24 9 227 1 ILTPS1 IDS-like terpene synthase 1 Melampsora lini
A0A858E4Y6 4.1e-08 57 26 10 243 1 ILTPS2 IDS-like terpene synthase 2 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
Q56RZ7 4.58e-08 57 27 11 237 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae var. lolii
Q56RZ3 4.58e-08 57 27 11 237 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae (strain Fl1)
P0C9E2 7.25e-08 56 29 7 195 3 Ken-086 Trans-prenyltransferase African swine fever virus (isolate Pig/Kenya/KEN-50/1950)
A0A1L7VFX3 8.13e-08 57 27 9 224 1 FUP1 Bifunctional terpene synthase FUP1 Fusarium proliferatum (strain ET1)
P0C9E1 1.03e-07 56 26 9 239 3 War-084 Trans-prenyltransferase African swine fever virus (isolate Warthog/Namibia/Wart80/1980)
A0A3S5XFG0 1.25e-07 56 24 8 245 1 cle6 Geranylgeranyl pyrophosphate synthase cle6 Aspergillus versicolor
A0A858E4Y8 1.49e-07 55 24 13 269 1 ILTPS1 IDS-like terpene synthase 1 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
A0A343W970 1.56e-07 55 26 11 244 1 FPPS Farnesyl pyrophosphate synthase Murgantia histrionica
F9WWF1 1.56e-07 55 26 8 224 3 GGS2 Geranylgeranyl pyrophosphate synthase 2 Zymoseptoria tritici (strain CBS 115943 / IPO323)
P0C9E0 1.64e-07 55 26 9 239 3 Pret-086 Trans-prenyltransferase African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)
Q6F5E6 1.71e-07 55 26 8 234 1 GGS Geranylgeranyl pyrophosphate synthase Neocamarosporium betae
Q8V9T7 2.04e-07 55 28 7 195 3 Mal-082 Trans-prenyltransferase African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983)
A0A1L9WQI2 2.07e-07 55 25 7 220 1 vrcA Bifunctional sesterterpene synthase Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A858E899 2.4e-07 55 25 10 240 1 ILTPS3 IDS-like terpene synthase 3 Melampsora lini
Q65164 2.45e-07 55 28 7 195 1 Ba71V-074 Trans-prenyltransferase African swine fever virus (strain Badajoz 1971 Vero-adapted)
A0A8D5M3Y5 2.57e-07 55 24 8 257 1 esdpD Geranylgeranyl pyrophosphate synthase esdpD Penicillium shearii
A0A7J6HWR9 4.42e-07 54 27 10 213 2 FPPS1 Farnesyl pyrophosphate synthase 1 Cannabis sativa
F9WZD2 8.12e-07 53 26 8 226 3 GGS1 Geranylgeranyl pyrophosphate synthase 1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A0P0ZEM1 8.73e-07 53 26 6 218 1 Stl-SS Stellatatriene synthase Emericella variicolor
P9WEP0 9.11e-07 53 23 6 212 1 AuAS Aspergildiene synthase Aspergillus ustus
A0A1B4XBK0 1.06e-06 53 25 5 231 3 sdnC Geranylgeranyl diphosphate synthase sdnC Sordaria araneosa
A0A2Z6AQX7 2.27e-06 52 25 7 238 1 PbSS Sesterbrasiliatriene synthase PbSS Penicillium brasilianum
A0A6S6QJ62 2.29e-06 52 28 5 232 1 ple4 Geranylgeranyl pyrophosphate synthase Rhodocybe pseudopiperita
A0A0U5G0B1 6.86e-06 51 27 6 182 1 AcldOS Ophiobolin F synthase Aspergillus calidoustus
A0A348FUE1 7.23e-06 51 24 7 221 1 PvCPS Copalyl diphosphate synthase Talaromyces verruculosus
A0A2L0VXR5 7.76e-06 50 28 5 232 2 GGPS Geranylgeranyl pyrophosphate synthase Clitopilus passeckerianus
Q9C446 1.36e-05 49 23 7 236 3 paxG Geranylgeranyl pyrophosphate synthase paxG Penicillium paxilli
M2V8C1 1.56e-05 50 25 7 252 1 oblA Ophiobolin F synthase oblA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
Q54BK1 1.91e-05 48 25 8 228 3 ggps1 Geranylgeranyl pyrophosphate synthase Dictyostelium discoideum
P49353 2.29e-05 48 27 11 216 2 FPS Farnesyl pyrophosphate synthase Zea mays
B2DBE8 2.67e-05 48 23 7 263 1 GGS-A Geranylgeranyl pyrophosphate synthase A Phomopsis amygdali
A0A1D8PH78 4.9e-05 48 29 9 198 1 ERG20 Farnesyl pyrophosphate synthase Candida albicans (strain SC5314 / ATCC MYA-2876)
B6HFX8 6.55e-05 48 23 5 223 1 PchDS Conidiogenone synthase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
P9WEV6 6.9e-05 48 26 7 228 1 PaPS Phomopsene synthase Phomopsis amygdali
P49349 7.18e-05 47 27 9 208 3 FPS1 Farnesyl pyrophosphate synthase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A0A1V1FVQ6 8.93e-05 47 25 6 216 1 oblA Ophiobolin F synthase oblA Emericella variicolor
K2SUY0 0.000114 47 23 5 231 1 MPH_02178 Macrophomene synthase Macrophomina phaseolina (strain MS6)
A0A2I6PJ13 0.000285 45 23 10 256 3 nodC Prenyl transferase nodC Hypoxylon pulicicidum
C9K2Q3 0.000413 45 24 8 238 1 bsc8 Fusicoccadiene synthase Alternaria brassicicola
A1DN30 0.000576 45 23 4 224 1 NfSS Sesterfisherol synthase Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
A0A8K1AY78 0.001 44 24 6 223 1 tndC Bifunctional type I diterpene synthase tndC Aspergillus flavipes

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17875
Feature type CDS
Gene ispA
Product (2E,6E)-farnesyl diphosphate synthase
Location 40222 - 41139 (strand: -1)
Length 918 (nucleotides) / 305 (amino acids)

Contig

Accession ZDB_702
Length 42793 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2251
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00348 Polyprenyl synthetase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0142 Coenzyme transport and metabolism (H) H Geranylgeranyl pyrophosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MPEQTPETFRNQLTQARERVDHVLDEILTTLPFAATDMGKAMHYGALLGGKRLRPFLVYATGEMFGVTAENLDAPAAAIECIHAYSLIHDDLPAMDDDTLRRGKPTCHVAFGEANAILAGDALQTQAFAILAARPMPDVRPQDRLAMIAELADAAGLGGMCGGQALDLAAEGKNIGIHALEQIHNHKTGALIRASVRMGAMSAGEAGYAVLPALDTYAQAIGLAFQVQDDILDVIGHTDVIGKSQGSDAAHGKSTYPSLLGLKAAQDKAQALYQESLAALSQLEEHHYNTATLRELANFVIERNS

Flanking regions ( +/- flanking 50bp)

AAACGACTGACCGCCCGGATCCGGCGGTTCCTGTGTGAACGAGAATGACCATGCCAGAACAAACTCCCGAAACATTCCGCAACCAACTGACACAGGCCAGAGAGCGTGTTGATCACGTTCTTGATGAGATCCTGACCACACTGCCGTTCGCCGCCACCGACATGGGTAAAGCCATGCATTACGGCGCCCTGCTCGGCGGAAAACGTCTGCGCCCGTTCCTGGTGTACGCCACCGGTGAAATGTTTGGTGTGACGGCTGAAAACCTGGATGCCCCGGCAGCAGCCATTGAGTGCATTCACGCCTATTCCCTGATCCATGACGATTTACCGGCCATGGATGACGACACACTGCGCCGCGGCAAACCAACCTGCCACGTCGCCTTTGGTGAAGCGAATGCTATTCTGGCGGGGGATGCCCTGCAAACCCAGGCATTTGCAATTCTCGCCGCCCGGCCGATGCCGGATGTCCGCCCGCAGGACCGTCTGGCGATGATCGCCGAACTGGCGGATGCCGCCGGTCTTGGCGGAATGTGCGGCGGCCAGGCACTTGATCTGGCAGCGGAAGGAAAAAACATCGGTATTCATGCGCTGGAACAAATACATAACCATAAGACCGGTGCTTTAATCCGTGCTTCCGTCCGTATGGGCGCGATGAGTGCCGGTGAAGCAGGCTATGCCGTATTACCGGCTCTCGACACTTACGCACAGGCTATCGGCCTGGCGTTTCAGGTTCAGGATGACATTCTGGATGTTATCGGTCATACGGATGTGATCGGAAAAAGCCAGGGCAGCGACGCCGCTCACGGGAAGAGCACATATCCGTCACTGCTCGGGCTGAAAGCGGCTCAGGATAAAGCACAGGCGCTTTATCAGGAATCACTGGCTGCGCTTTCACAGCTTGAAGAACATCATTACAACACAGCAACCCTGCGTGAACTTGCTAATTTTGTGATTGAACGTAACAGCTAATCCGTCCGGCACGTTCCGGTATTTTCAGAAACTTTAATAAGAATTAGTGA