Homologs in group_3116

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19785 FBDBKF_19785 100.0 Morganella morganii S1 - DUF2543 domain-containing protein
EHELCC_10510 EHELCC_10510 100.0 Morganella morganii S2 - DUF2543 domain-containing protein
NLDBIP_10855 NLDBIP_10855 100.0 Morganella morganii S4 - DUF2543 domain-containing protein
LHKJJB_10500 LHKJJB_10500 100.0 Morganella morganii S3 - DUF2543 domain-containing protein
F4V73_RS11035 F4V73_RS11035 91.4 Morganella psychrotolerans - DUF2543 family protein

Distribution of the homologs in the orthogroup group_3116

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3116

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACV9 9.4e-34 113 70 0 81 4 ymjA Uncharacterized protein YmjA Shigella flexneri
P0ACV8 9.4e-34 113 70 0 81 4 ymjA Uncharacterized protein YmjA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16665
Feature type CDS
Gene -
Product DUF2543 domain-containing protein
Location 63401 - 63646 (strand: 1)
Length 246 (nucleotides) / 81 (amino acids)
In genomic island -

Contig

Accession ZDB_697
Length 66671 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3116
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF10820 Protein of unknown function (DUF2543)

Protein Sequence

MENIVPDKYYDIADEYALESEEPVEEQEYDGLAHYFQLLITCLTNNEEISEEAQKKMAAEAGINKQRIDDIAEFLNRWGND

Flanking regions ( +/- flanking 50bp)

CAATGGTGTGATACACACCACTGACACCGGCGTTAGCCCCGGAGGAATTTATGGAAAATATAGTACCGGATAAATACTACGATATCGCTGATGAGTACGCGCTGGAATCGGAAGAGCCGGTTGAAGAGCAGGAGTATGACGGACTGGCGCACTATTTTCAGTTACTGATCACCTGTCTGACGAACAATGAAGAGATCAGTGAGGAAGCCCAGAAAAAGATGGCAGCTGAAGCCGGTATTAATAAACAGCGTATCGATGATATCGCTGAATTTCTCAACCGCTGGGGTAATGATTAAGTCACTATCAGCGCCGGACACAAAAAAACCGGGATAACAGTATTCCTGTT