Homologs in group_3588

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19805 FBDBKF_19805 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_10530 EHELCC_10530 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_10875 NLDBIP_10875 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_10480 LHKJJB_10480 100.0 Morganella morganii S3 - hypothetical protein

Distribution of the homologs in the orthogroup group_3588

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3588

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16645
Feature type CDS
Gene -
Product hypothetical protein
Location 59160 - 59255 (strand: -1)
Length 96 (nucleotides) / 31 (amino acids)

Contig

Accession ZDB_697
Length 66671 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3588
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MKNSISSWGIILLCLLTWTADIIIIYGETVV

Flanking regions ( +/- flanking 50bp)

ATTGTCCGCCGGATAAGAGAACTGCAACGTGAGCGGGCCGGAGTCTGCGTATGAAAAATAGTATCTCATCGTGGGGGATTATTTTGCTCTGCCTGCTGACGTGGACAGCAGATATCATCATTATTTACGGGGAAACGGTTGTATGAACGCCTTACTGACACAAATTCTGATGGAGCTGAAATCCGGTAATCTTCAC