Homologs in group_3464

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15725 FBDBKF_15725 100.0 Morganella morganii S1 merT mercuric transport protein MerT
EHELCC_16080 EHELCC_16080 100.0 Morganella morganii S2 merT mercuric transport protein MerT
NLDBIP_16285 NLDBIP_16285 100.0 Morganella morganii S4 merT mercuric transport protein MerT
LHKJJB_16515 LHKJJB_16515 100.0 Morganella morganii S3 merT mercuric transport protein MerT

Distribution of the homologs in the orthogroup group_3464

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3464

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q51769 3.28e-76 223 99 0 116 3 merT Mercuric transport protein MerT Pseudomonas fluorescens
P94185 1.15e-72 214 93 0 116 3 merT Mercuric transport protein MerT Alcaligenes sp.
Q52106 2.11e-72 214 93 0 116 3 merT Mercuric transport protein MerT Acinetobacter calcoaceticus
P0A220 8.13e-72 212 92 0 116 3 merT Mercuric transport protein MerT Shigella flexneri
P0A219 8.13e-72 212 92 0 116 3 merT Mercuric transport protein MerT Salmonella typhi
P94700 8.56e-72 213 93 0 115 3 merT Mercuric transport protein MerT Enterobacter agglomerans
P04140 1.77e-71 211 93 0 116 1 merT Mercuric transport protein MerT Pseudomonas aeruginosa
P13112 7.03e-68 202 93 0 116 3 merT Mercuric transport protein MerT Serratia marcescens
Q54462 7.83e-28 101 51 0 102 3 merT Mercuric transport protein MerT Shewanella putrefaciens

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16285
Feature type CDS
Gene merT
Product mercuric transport protein MerT
Location 77255 - 77605 (strand: -1)
Length 351 (nucleotides) / 116 (amino acids)

Contig

Accession ZDB_696
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3464
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF02411 MerT mercuric transport protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08363 mercuric ion transport protein - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
merT mercuric transport protein MerT plus STRESS MERCURY MERCURY None

Protein Sequence

MSEPQNGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGVALVALFFAWRRIYRPSAACKPGEVCAIPQVRATYKLIFWGVAVLVLVALGFPYVVPFFY

Flanking regions ( +/- flanking 50bp)

CTACGGAAGTAAGCTTAAGCTATCCAATTCAGATTCGAAAGGACAAACGTATGTCTGAACCTCAAAACGGGCGCGGCGCGCTCTTCACTGGCGGGCTGGCCGCCATCCTCGCCTCGGCTTGCTGCCTCGGGCCGCTGGTTCTGATCGCCTTGGGGTTCAGCGGCGCTTGGATCGGCAACTTGACGGTGTTGGAACCCTATCGCCCCATCTTTATCGGCGTGGCGCTGGTGGCGTTGTTCTTCGCCTGGCGGCGCATCTACCGGCCGTCAGCCGCCTGCAAACCGGGTGAGGTTTGCGCGATTCCCCAAGTGCGAGCTACTTACAAGCTCATTTTCTGGGGCGTGGCCGTGCTGGTTTTGGTCGCGCTCGGATTTCCCTACGTCGTGCCATTTTTCTATTGATCACAGGAGTTCACCATGAAAAAGCTGCTTTCCGCCCTTGCCCTCGCTGC