Homologs in group_3463

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15715 FBDBKF_15715 100.0 Morganella morganii S1 merF mercury resistance system transport protein MerF
EHELCC_16070 EHELCC_16070 100.0 Morganella morganii S2 merF mercury resistance system transport protein MerF
NLDBIP_16295 NLDBIP_16295 100.0 Morganella morganii S4 merF mercury resistance system transport protein MerF
LHKJJB_16505 LHKJJB_16505 100.0 Morganella morganii S3 merF mercury resistance system transport protein MerF

Distribution of the homologs in the orthogroup group_3463

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3463

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16275
Feature type CDS
Gene merF
Product mercury resistance system transport protein MerF
Location 76716 - 76961 (strand: -1)
Length 246 (nucleotides) / 81 (amino acids)

Contig

Accession ZDB_696
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3463
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF11431 Membrane transport protein MerF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19058 mercuric ion transport protein - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
merF mercury resistance system transport protein MerF plus STRESS MERCURY MERCURY NF033565 

Protein Sequence

MKDPKTLLRVSIIGTTLVALCCFTPVLVILLGVVGLSALTGYLDYVLLPALEIFIGLTIYAIQRKRQADACCTPKFNGVKK

Flanking regions ( +/- flanking 50bp)

ACCAAGGCTACCGAGGATGCGGGCTACCCATCATCAGTCAAGAACTGATCATGAAAGACCCGAAGACACTGCTGCGGGTCAGCATCATTGGCACAACCCTCGTGGCGCTGTGTTGCTTCACCCCTGTTCTGGTCATTTTGCTCGGTGTGGTCGGCTTGTCCGCGCTGACCGGCTATCTGGACTATGTGCTGCTGCCTGCGCTGGAGATTTTCATCGGCTTGACCATCTACGCCATCCAACGAAAACGCCAAGCCGATGCCTGCTGCACCCCGAAATTCAATGGAGTAAAAAAATGACCGAAATCACCGTGAATGGCATGACCTGCACATCCTGCGCCTCCCATGTC