Homologs in group_1655

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10995 FBDBKF_10995 100.0 Morganella morganii S1 psiE phosphate-starvation-inducible protein PsiE
EHELCC_05230 EHELCC_05230 100.0 Morganella morganii S2 psiE phosphate-starvation-inducible protein PsiE
NLDBIP_05550 NLDBIP_05550 100.0 Morganella morganii S4 psiE phosphate-starvation-inducible protein PsiE
LHKJJB_02430 LHKJJB_02430 100.0 Morganella morganii S3 psiE phosphate-starvation-inducible protein PsiE
F4V73_RS08230 F4V73_RS08230 90.2 Morganella psychrotolerans psiE phosphate-starvation-inducible protein PsiE
PMI_RS07860 PMI_RS07860 61.8 Proteus mirabilis HI4320 psiE phosphate-starvation-inducible protein PsiE

Distribution of the homologs in the orthogroup group_1655

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1655

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C5B6Z4 5.58e-56 174 62 1 131 3 psiE Protein PsiE homolog Edwardsiella ictaluri (strain 93-146)
Q72Y02 4.21e-49 156 56 0 133 3 psiE Protein PsiE homolog Bacillus cereus (strain ATCC 10987 / NRS 248)
B1JJM9 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664X0 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CNS3 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pestis bv. Antiqua (strain Nepal516)
A9R535 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAS3 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pestis
B2K4Y4 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CC26 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDG9 2.7e-48 154 61 1 129 3 psiE Protein PsiE homolog Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6TGU1 4.55e-48 154 57 0 125 3 psiE Protein PsiE homolog Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6HBH8 4.88e-48 154 56 0 131 3 psiE Protein PsiE homolog Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81XB6 4.88e-48 154 56 0 131 3 psiE Protein PsiE homolog Bacillus anthracis
A4TH40 8.06e-48 153 61 1 129 3 psiE Protein PsiE homolog Yersinia pestis (strain Pestoides F)
A4W5E5 1.56e-46 150 56 0 125 3 psiE Protein PsiE homolog Enterobacter sp. (strain 638)
A1JRV7 5.26e-46 148 59 1 129 3 psiE Protein PsiE homolog Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DBD8 7.72e-46 148 58 1 129 3 psiE Protein PsiE homolog Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D2A1 1.75e-45 147 58 1 129 3 psiE Protein PsiE homolog Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GKC9 3.77e-45 146 63 1 129 3 psiE Protein PsiE homolog Serratia proteamaculans (strain 568)
B5XY00 8.07e-43 140 58 0 125 3 psiE Protein PsiE homolog Klebsiella pneumoniae (strain 342)
Q0SXP7 3.37e-40 134 56 0 125 3 psiE Protein PsiE Shigella flexneri serotype 5b (strain 8401)
B5Z171 1.31e-38 130 57 0 125 3 psiE Protein PsiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5X8 1.31e-38 130 57 0 125 3 psiE Protein PsiE Escherichia coli O157:H7
B7NFX5 2.33e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R3Q5 2.38e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain UTI89 / UPEC)
A1AIK9 2.38e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O1:K1 / APEC
B7MJ22 2.38e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YUV5 2.97e-38 129 56 0 125 3 psiE Protein PsiE Shigella sonnei (strain Ss046)
P0A7D0 2.97e-38 129 56 0 125 3 psiE Protein PsiE Shigella flexneri
Q328Y4 2.97e-38 129 56 0 125 3 psiE Protein PsiE Shigella dysenteriae serotype 1 (strain Sd197)
B7LL03 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LPJ6 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain SMS-3-5 / SECEC)
B6I5P4 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain SE11)
P0A7C8 2.97e-38 129 56 0 125 1 psiE Protein PsiE Escherichia coli (strain K12)
B1IUM1 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7C9 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA30 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A7D0 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O9:H4 (strain HS)
B1XC29 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain K12 / DH10B)
C5A0W8 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7U2 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O8 (strain IAI1)
B7N2N9 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O81 (strain ED1a)
B7NRZ5 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LAX3 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli (strain 55989 / EAEC)
B7UPJ2 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUQ1 2.97e-38 129 56 0 125 3 psiE Protein PsiE Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MHA2 3.42e-38 129 56 0 125 3 psiE Protein PsiE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0A279 3.77e-38 129 57 0 125 2 psiE Protein PsiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A280 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella typhi
C0Q4D1 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella paratyphi C (strain RKS4594)
A9N1K2 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T1S0 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella newport (strain SL254)
B4TDK9 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella heidelberg (strain SL476)
B5FQQ0 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella dublin (strain CT_02021853)
Q57H01 3.77e-38 129 57 0 125 3 psiE Protein PsiE Salmonella choleraesuis (strain SC-B67)
B4TQP3 1.23e-37 127 57 0 125 3 psiE Protein PsiE Salmonella schwarzengrund (strain CVM19633)
B5BJU9 1.23e-37 127 58 0 125 3 psiE Protein PsiE Salmonella paratyphi A (strain AKU_12601)
Q5PL02 1.23e-37 127 58 0 125 3 psiE Protein PsiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5QYI9 1.23e-37 127 57 0 125 3 psiE Protein PsiE Salmonella enteritidis PT4 (strain P125109)
B5F1P5 1.23e-37 127 57 0 125 3 psiE Protein PsiE Salmonella agona (strain SL483)
B5R7S5 1.68e-37 127 57 0 125 3 psiE Protein PsiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q813A6 4.2e-36 123 50 0 120 3 psiE Protein PsiE homolog Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0AGW6 7.99e-31 110 51 1 129 3 psiE Protein PsiE homolog Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y8Q9 7.99e-31 110 51 1 129 3 psiE Protein PsiE homolog Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q721Y1 7.99e-31 110 51 1 129 3 psiE Protein PsiE homolog Listeria monocytogenes serotype 4b (strain F2365)
C1L1A5 7.99e-31 110 51 1 129 3 psiE Protein PsiE homolog Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DGC6 1.38e-30 109 51 1 129 3 psiE Protein PsiE homolog Listeria monocytogenes serotype 4a (strain HCC23)
Q92DI5 1.38e-30 109 51 1 129 3 psiE Protein PsiE homolog Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A7Z6Z1 1.49e-28 104 42 1 123 3 psiE Protein PsiE homolog Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q4QMJ5 4.09e-28 103 47 1 128 3 psiE Protein PsiE homolog Haemophilus influenzae (strain 86-028NP)
P54445 2.08e-26 99 42 1 123 3 psiE Protein PsiE homolog Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15810
Feature type CDS
Gene psiE
Product phosphate-starvation-inducible protein PsiE
Location 80048 - 80449 (strand: -1)
Length 402 (nucleotides) / 133 (amino acids)

Contig

Accession ZDB_695
Length 101591 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1655
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06146 Phosphate-starvation-inducible E family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3223 General function prediction only (R) R Phosphate starvation-inducible membrane PsiE (function unknown)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13256 protein PsiE - -

Protein Sequence

MEFQPSRQIATVLQWVLNIALLILGVLLIVFMGKETLTLINLLFSAQEKTTYLLLDSIVTYFLYFEFIALIVKYFSSGYHFPLRYFIYIGITAMVRLIIVDHSDANATFLHTLSILALTVALYLANTDKLKRS

Flanking regions ( +/- flanking 50bp)

CCCATACTGTTTACGGGCGTAATTGTCGTCTATCACTGAGGCTATTGATTATGGAATTTCAGCCATCCCGCCAGATAGCAACTGTGCTGCAATGGGTTCTGAATATTGCACTGCTGATTTTAGGTGTGCTGCTGATTGTATTTATGGGAAAGGAAACACTGACGCTGATTAATCTGCTGTTTTCCGCGCAGGAGAAAACAACCTATCTGTTATTAGACAGTATCGTGACCTATTTCCTCTATTTTGAATTTATTGCCTTAATTGTGAAATATTTTTCGTCGGGCTACCATTTCCCTCTGCGCTATTTTATCTATATCGGCATTACGGCGATGGTGCGTTTAATTATTGTCGATCATTCAGATGCCAATGCGACATTCCTGCATACCCTGTCAATACTGGCGCTGACTGTGGCGTTATATCTGGCAAATACCGATAAGCTTAAACGCAGCTGAAATAACATGCCCCGCAGTGACGCGGGGCAGAATAAACAGACTGACGGGAT