Homologs in group_2896

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11320 FBDBKF_11320 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_17895 EHELCC_17895 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_05225 NLDBIP_05225 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_02105 LHKJJB_02105 100.0 Morganella morganii S3 - hypothetical protein
F4V73_RS19590 F4V73_RS19590 65.0 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2896

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2896

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15485
Feature type CDS
Gene -
Product hypothetical protein
Location 30597 - 30719 (strand: -1)
Length 123 (nucleotides) / 40 (amino acids)
In genomic island -

Contig

Accession ZDB_695
Length 101591 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2896
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MTCAICSKELTDDEVYVCDQCANECPHLEVVEKIKGDGDD

Flanking regions ( +/- flanking 50bp)

GAGATTGTTCGCCAGCGGGTTCCGGAATCTGAATATGAGGACTGGTTTAAATGACTTGCGCAATATGCAGTAAAGAACTTACCGACGATGAAGTTTATGTCTGTGACCAATGCGCCAATGAATGCCCGCATCTGGAAGTAGTCGAGAAGATAAAAGGAGATGGTGATGATTAAACGCATCCTGGGATATCTGAGTAATCCGTTCACTCTGAGTTGGGTGATAT