Homologs in group_156

Help

9 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18605 FBDBKF_18605 100.0 Morganella morganii S1 - DUF3168 domain-containing protein
FBDBKF_19380 FBDBKF_19380 93.0 Morganella morganii S1 - DUF3168 domain-containing protein
EHELCC_15180 EHELCC_15180 100.0 Morganella morganii S2 - DUF3168 domain-containing protein
EHELCC_19280 EHELCC_19280 93.0 Morganella morganii S2 - DUF3168 domain-containing protein
NLDBIP_15710 NLDBIP_15710 100.0 Morganella morganii S4 - DUF3168 domain-containing protein
NLDBIP_19410 NLDBIP_19410 93.0 Morganella morganii S4 - DUF3168 domain-containing protein
LHKJJB_16130 LHKJJB_16130 100.0 Morganella morganii S3 - DUF3168 domain-containing protein
LHKJJB_19395 LHKJJB_19395 93.0 Morganella morganii S3 - DUF3168 domain-containing protein
HKOGLL_19215 HKOGLL_19215 93.0 Morganella morganii S5 - DUF3168 domain-containing protein

Distribution of the homologs in the orthogroup group_156

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_156

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15250
Feature type CDS
Gene -
Product DUF3168 domain-containing protein
Location 105101 - 105490 (strand: 1)
Length 390 (nucleotides) / 129 (amino acids)
In genomic island -

Contig

Accession ZDB_694
Length 115897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_156
Orthogroup size 10
N. genomes 5

Actions

Genomic region

Protein Sequence

MIESDLKSSLSAITAMPVFPLLLPKDAQEGITFQRISDPRYSAGMVTTHLIVARFQIGIHVLNDYEKALLLDKAIRDAWEPIVHGYIGNHPVQTVQRGGLQQGKEELTNNTVRWSVMRDFIITYPEDAS

Flanking regions ( +/- flanking 50bp)

CCGTAACGATCCGGCGAAACTGATTATTACCACGGAGGCAGACATACGACATGATCGAAAGTGACCTTAAGTCGTCTCTTTCCGCTATCACCGCAATGCCCGTTTTCCCCCTGTTATTACCGAAAGATGCACAGGAAGGTATCACCTTTCAGCGCATCAGCGACCCGCGTTATTCCGCCGGTATGGTCACCACTCATCTTATCGTGGCGCGTTTTCAGATAGGCATTCACGTACTGAATGACTACGAAAAAGCCCTGCTGCTGGATAAAGCAATCCGTGATGCCTGGGAACCGATCGTGCATGGTTACATCGGAAATCACCCGGTGCAGACGGTACAGCGCGGCGGATTGCAGCAGGGGAAAGAAGAGCTGACAAATAACACTGTCCGTTGGTCGGTAATGCGGGATTTTATTATCACTTATCCGGAGGATGCATCATGAGAACAACGGTTAAGGTTTCCGGCCTTGACGGGCTGGAAGCGGAGCTGATG