Homologs in group_1755

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12225 FBDBKF_12225 100.0 Morganella morganii S1 rpmE 50S ribosomal protein L31
EHELCC_14080 EHELCC_14080 100.0 Morganella morganii S2 rpmE 50S ribosomal protein L31
NLDBIP_15175 NLDBIP_15175 100.0 Morganella morganii S4 rpmE 50S ribosomal protein L31
LHKJJB_15435 LHKJJB_15435 100.0 Morganella morganii S3 rpmE 50S ribosomal protein L31
F4V73_RS17055 F4V73_RS17055 93.0 Morganella psychrotolerans rpmE 50S ribosomal protein L31
PMI_RS15925 PMI_RS15925 84.3 Proteus mirabilis HI4320 rpmE 50S ribosomal protein L31

Distribution of the homologs in the orthogroup group_1755

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1755

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JQ70 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G80 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS79 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis (strain Pestoides F)
Q1CD60 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4I7 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Angola)
P58471 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis
B2JZD1 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBE3 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCZ0 4.41e-43 136 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6CZ96 3.33e-42 134 85 0 71 3 rpmE Large ribosomal subunit protein bL31 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TGC6 4.35e-42 134 85 0 70 3 rpmE Large ribosomal subunit protein bL31 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8GL91 6.09e-42 133 84 0 71 3 rpmE Large ribosomal subunit protein bL31 Serratia proteamaculans (strain 568)
B5XZ32 1.44e-41 132 84 0 70 3 rpmE Large ribosomal subunit protein bL31 Klebsiella pneumoniae (strain 342)
B4F176 1.63e-40 130 84 0 70 3 rpmE Large ribosomal subunit protein bL31 Proteus mirabilis (strain HI4320)
A1JI13 1.78e-40 129 81 0 71 3 rpmE Large ribosomal subunit protein bL31 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VI89 3.12e-40 129 82 0 70 3 rpmE Large ribosomal subunit protein bL31 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MYC6 2.98e-39 126 78 0 71 3 rpmE Large ribosomal subunit protein bL31 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YV42 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Shigella sonnei (strain Ss046)
Q32AA9 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U54 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Shigella boydii serotype 4 (strain Sb227)
B2TWD3 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUR8 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0C203 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain UTI89 / UPEC)
B1LNP1 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain SMS-3-5 / SECEC)
B6I4S9 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain SE11)
B7NFN5 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7M9 1.2e-38 125 78 0 70 1 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12)
B1IVE3 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C076 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAC8 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A742 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O9:H4 (strain HS)
B1XBA2 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12 / DH10B)
C5A0A3 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Y7 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O8 (strain IAI1)
B7N2S7 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O81 (strain ED1a)
B7NU69 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ77 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7N0 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O157:H7
B7LA33 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain 55989 / EAEC)
B7MI68 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNQ6 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUF1 1.2e-38 125 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O139:H28 (strain E24377A / ETEC)
P66191 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66192 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella typhi
B4TPV7 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella schwarzengrund (strain CVM19633)
B5BJL3 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella paratyphi A (strain AKU_12601)
C0Q446 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella paratyphi C (strain RKS4594)
A9MZI7 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK51 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0U3 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella newport (strain SL254)
B4TCN3 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella heidelberg (strain SL476)
B5RF75 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXM5 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella enteritidis PT4 (strain P125109)
B5FPU5 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella dublin (strain CT_02021853)
Q57HC1 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella choleraesuis (strain SC-B67)
B5F0S7 3.11e-38 124 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Salmonella agona (strain SL483)
A4WG62 3.75e-38 124 80 0 70 3 rpmE Large ribosomal subunit protein bL31 Enterobacter sp. (strain 638)
Q2NQY5 4.8e-38 123 78 0 71 3 rpmE Large ribosomal subunit protein bL31 Sodalis glossinidius (strain morsitans)
Q83PD4 5.21e-38 123 77 0 70 3 rpmE Large ribosomal subunit protein bL31 Shigella flexneri
B8F5P3 1.56e-37 122 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Glaesserella parasuis serovar 5 (strain SH0165)
B0BPS5 2.06e-37 122 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXX5 2.06e-37 122 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0Z0 2.06e-37 122 78 0 70 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65VF5 2.16e-37 122 76 0 71 3 rpmE Large ribosomal subunit protein bL31 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CLR7 2.99e-37 121 77 0 70 3 rpmE Large ribosomal subunit protein bL31 Pasteurella multocida (strain Pm70)
B0URX8 1.27e-36 120 77 0 70 3 rpmE Large ribosomal subunit protein bL31 Histophilus somni (strain 2336)
A7ML80 3.86e-36 119 75 0 70 3 rpmE Large ribosomal subunit protein bL31 Cronobacter sakazakii (strain ATCC BAA-894)
A6VLQ3 5.39e-36 118 74 0 71 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q59450 1.25e-35 117 75 0 70 3 rpmE Large ribosomal subunit protein bL31 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P44367 1.02e-34 115 72 0 70 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHR2 1.02e-34 115 72 0 70 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain PittGG)
A5UDW7 1.02e-34 115 72 0 70 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain PittEE)
Q07WM9 1.8e-34 114 71 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella frigidimarina (strain NCIMB 400)
Q4QME1 1.82e-34 114 71 0 70 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain 86-028NP)
Q12IU6 3.61e-33 111 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KK45 7.28e-33 110 70 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella woodyi (strain ATCC 51908 / MS32)
B4RYA0 1.07e-32 110 71 0 70 3 rpmE Large ribosomal subunit protein bL31 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H950 1.72e-32 109 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TVU8 1.72e-32 109 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella halifaxensis (strain HAW-EB4)
A1S2Q1 2.87e-32 109 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3Q9V5 4.51e-32 108 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9KYT2 4.56e-32 108 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS195)
A6WIK6 4.56e-32 108 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS185)
A3D9A0 4.56e-32 108 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6H2 4.56e-32 108 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS223)
Q15N51 9.15e-32 107 67 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A8FQM5 1.34e-31 107 68 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella sediminis (strain HAW-EB3)
Q8E9Z0 1.37e-31 107 67 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4SHF6 2.11e-31 107 69 0 71 3 rpmE Large ribosomal subunit protein bL31 Aeromonas salmonicida (strain A449)
P57639 3.75e-31 106 70 0 64 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8E0 3.75e-31 106 70 0 64 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q0HZJ3 4.28e-31 106 67 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain MR-7)
Q0HEF8 4.28e-31 106 67 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain MR-4)
A0L1H0 4.28e-31 106 67 0 70 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain ANA-3)
A1TYV1 4.54e-31 106 70 0 64 3 rpmE Large ribosomal subunit protein bL31 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4XPP1 9.03e-31 105 67 0 70 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas mendocina (strain ymp)
B8D897 9.96e-31 105 68 0 64 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
C1DHR5 5e-30 103 64 0 70 3 rpmE Large ribosomal subunit protein bL31 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A6W2U2 5.37e-30 103 61 0 71 3 rpmE Large ribosomal subunit protein bL31 Marinomonas sp. (strain MWYL1)
A1SYJ9 1.27e-29 102 62 0 70 3 rpmE Large ribosomal subunit protein bL31 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8K907 1.4e-29 102 65 0 66 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C4K3J7 8.44e-29 100 61 0 71 3 rpmE Large ribosomal subunit protein bL31 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7VLM2 1.07e-28 100 65 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio atlanticus (strain LGP32)
Q2S9P7 1.55e-28 99 65 0 64 3 rpmE Large ribosomal subunit protein bL31 Hahella chejuensis (strain KCTC 2396)
Q47W08 1.96e-28 99 62 0 70 3 rpmE Large ribosomal subunit protein bL31 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C5BRK5 2.48e-28 99 64 0 65 3 rpmE Large ribosomal subunit protein bL31 Teredinibacter turnerae (strain ATCC 39867 / T7901)
C4L9Y1 3.5e-28 99 65 1 70 3 rpmE Large ribosomal subunit protein bL31 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6EMM4 1.03e-27 97 63 1 72 3 rpmE Large ribosomal subunit protein bL31 Aliivibrio salmonicida (strain LFI1238)
Q3IJB4 1.39e-27 97 61 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudoalteromonas translucida (strain TAC 125)
Q87T15 1.46e-27 97 63 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LTT8 1.93e-27 97 65 0 66 3 rpmE Large ribosomal subunit protein bL31 Baumannia cicadellinicola subsp. Homalodisca coagulata
C3LSA8 2.23e-27 97 63 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNQ2 2.23e-27 97 63 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4V7 2.23e-27 97 63 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LVH8 3.66e-27 96 60 0 70 3 rpmE Large ribosomal subunit protein bL31 Photobacterium profundum (strain SS9)
A7MWI1 3.91e-27 96 62 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio campbellii (strain ATCC BAA-1116)
B5FBA6 7.15e-27 95 62 1 72 3 rpmE Large ribosomal subunit protein bL31 Aliivibrio fischeri (strain MJ11)
Q5E2H8 7.15e-27 95 62 1 72 3 rpmE Large ribosomal subunit protein bL31 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q21H76 7.4e-27 95 57 0 70 3 rpmE Large ribosomal subunit protein bL31 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B5ENM4 1.28e-26 94 62 0 64 3 rpmE Large ribosomal subunit protein bL31 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5V5 1.28e-26 94 62 0 64 3 rpmE Large ribosomal subunit protein bL31 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q9HUD0 2.13e-26 94 60 0 71 1 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EW8 2.13e-26 94 60 0 71 1 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3E2 2.13e-26 94 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain LESB58)
A6VDH0 3.53e-26 94 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain PA7)
Q1QZZ2 4.07e-26 93 59 0 64 3 rpmE Large ribosomal subunit protein bL31 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8DCN9 4.96e-26 93 62 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio vulnificus (strain CMCP6)
Q7MH61 5.18e-26 93 62 1 72 3 rpmE Large ribosomal subunit protein bL31 Vibrio vulnificus (strain YJ016)
Q4KJJ8 7.36e-26 93 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5NHS9 1.3e-25 92 61 1 65 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFJ3 1.3e-25 92 61 1 65 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14J81 1.3e-25 92 61 1 65 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. tularensis (strain FSC 198)
Q89A32 1.83e-25 92 57 0 68 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2A2S8 1.9e-25 92 61 1 65 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. holarctica (strain LVS)
Q48PI0 2.18e-25 92 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5QV44 3.18e-25 91 55 0 70 3 rpmE Large ribosomal subunit protein bL31 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0VMB0 3.71e-25 91 54 0 71 3 rpmE Large ribosomal subunit protein bL31 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4ZZF3 3.99e-25 91 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas syringae pv. syringae (strain B728a)
Q3KJB1 4.78e-25 90 57 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain Pf0-1)
A0Q4M1 5.19e-25 90 60 1 65 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. novicida (strain U112)
Q87V05 9.07e-25 90 60 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3JEH3 1.64e-24 89 52 0 68 3 rpmE Large ribosomal subunit protein bL31 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q491Y5 1.78e-24 89 59 0 66 3 rpmE Large ribosomal subunit protein bL31 Blochmanniella pennsylvanica (strain BPEN)
Q88CU3 1.83e-24 89 56 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q056X4 4.77e-24 88 59 0 64 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0KN41 7.89e-24 87 54 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain GB-1)
Q6FAA5 9.64e-24 87 57 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q82VN1 1.6e-23 87 56 0 64 3 rpmE Large ribosomal subunit protein bL31 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1J2I5 2.85e-23 86 54 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain W619)
B0VBX6 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AYE)
A3M7E7 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VUE9 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain SDF)
B2HVM2 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain ACICU)
B7I4A2 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AB0057)
B7GZ34 3.97e-23 86 54 1 66 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AB307-0294)
Q8D2S5 5.5e-23 85 59 0 64 3 rpmE Large ribosomal subunit protein bL31 Wigglesworthia glossinidia brevipalpis
Q73MK4 1.85e-22 84 51 1 66 3 rpmE Large ribosomal subunit protein bL31 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q2Y791 3.38e-22 84 53 0 64 3 rpmE Large ribosomal subunit protein bL31 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1IGB6 4e-22 83 53 0 71 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas entomophila (strain L48)
Q7VRL2 5.68e-22 83 62 0 58 3 rpmE Large ribosomal subunit protein bL31 Blochmanniella floridana
B2S2K3 9.47e-22 82 51 1 66 3 rpmE Large ribosomal subunit protein bL31 Treponema pallidum subsp. pallidum (strain SS14)
O66075 9.47e-22 82 51 1 66 3 rpmE Large ribosomal subunit protein bL31 Treponema pallidum (strain Nichols)
B0S2B9 1.22e-21 82 55 2 67 3 rpmE Large ribosomal subunit protein bL31 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q3SMP9 1.32e-21 82 53 1 67 3 rpmE Large ribosomal subunit protein bL31 Thiobacillus denitrificans (strain ATCC 25259)
Q6A8B4 1.58e-21 82 55 1 65 1 rpmE Large ribosomal subunit protein bL31 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8J4R6 1.79e-21 82 52 0 65 3 rpmE Large ribosomal subunit protein bL31 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q60BZ1 2.11e-21 81 50 0 64 3 rpmE Large ribosomal subunit protein bL31 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5WYQ0 2.46e-21 81 47 0 70 3 rpmE Large ribosomal subunit protein bL31 Legionella pneumophila (strain Lens)
Q5ZXT1 2.46e-21 81 47 0 70 3 rpmE Large ribosomal subunit protein bL31 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IGQ8 2.46e-21 81 47 0 70 3 rpmE Large ribosomal subunit protein bL31 Legionella pneumophila (strain Corby)
Q5X7A1 2.46e-21 81 47 0 70 3 rpmE Large ribosomal subunit protein bL31 Legionella pneumophila (strain Paris)
Q7NX81 2.61e-21 81 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q83D39 3.06e-21 81 50 0 65 3 rpmE Large ribosomal subunit protein bL31 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND11 3.06e-21 81 50 0 65 3 rpmE Large ribosomal subunit protein bL31 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KG10 3.06e-21 81 50 0 65 3 rpmE Large ribosomal subunit protein bL31 Coxiella burnetii (strain Dugway 5J108-111)
B6J0G0 3.06e-21 81 50 0 65 3 rpmE Large ribosomal subunit protein bL31 Coxiella burnetii (strain CbuG_Q212)
B5EDS6 3.14e-21 81 50 1 69 3 rpmE Large ribosomal subunit protein bL31 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8KC50 3.27e-21 81 50 1 71 3 rpmE Large ribosomal subunit protein bL31 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A1A0I8 4.81e-21 80 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q3A127 5.7e-21 80 47 0 65 3 rpmE Large ribosomal subunit protein bL31 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5P0T2 5.84e-21 80 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2LWU8 6.21e-21 80 47 1 71 3 rpmE Large ribosomal subunit protein bL31 Syntrophus aciditrophicus (strain SB)
P66190 7.57e-21 80 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66189 7.57e-21 80 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F513 8.73e-21 80 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7ULT4 9.03e-21 80 51 1 66 3 rpmE Large ribosomal subunit protein bL31 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q1B541 1.02e-20 80 52 1 72 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain MCS)
A1UJZ6 1.02e-20 80 52 1 72 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain KMS)
A3Q3C3 1.02e-20 80 52 1 72 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain JLS)
A1K5N3 1.08e-20 80 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Azoarcus sp. (strain BH72)
Q3B5Z4 1.54e-20 79 52 2 72 3 rpmE Large ribosomal subunit protein bL31 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q73X47 1.73e-20 79 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QCW6 1.73e-20 79 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium avium (strain 104)
A0L3X0 2.01e-20 79 55 2 67 3 rpmE Large ribosomal subunit protein bL31 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C6E7G6 2.02e-20 79 49 1 69 3 rpmE Large ribosomal subunit protein bL31 Geobacter sp. (strain M21)
A5CVK6 2.16e-20 79 53 1 66 3 rpmE Large ribosomal subunit protein bL31 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q30P97 3.22e-20 78 50 1 65 3 rpmE Large ribosomal subunit protein bL31 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P45834 3.34e-20 79 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium leprae (strain TN)
B8ZR30 3.34e-20 79 55 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium leprae (strain Br4923)
C1D7F6 4.23e-20 78 49 1 65 3 rpmE Large ribosomal subunit protein bL31 Laribacter hongkongensis (strain HLHK9)
C3KAH5 4.25e-20 78 56 0 64 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain SBW25)
Q02DD2 4.67e-20 78 46 0 64 3 rpmE Large ribosomal subunit protein bL31 Solibacter usitatus (strain Ellin6076)
B8GPB9 4.75e-20 78 50 1 67 3 rpmE Large ribosomal subunit protein bL31 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q47BQ2 5.22e-20 78 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Dechloromonas aromatica (strain RCB)
Q0SGN7 5.25e-20 78 49 1 71 3 rpmE Large ribosomal subunit protein bL31 Rhodococcus jostii (strain RHA1)
A8FID6 5.52e-20 78 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Bacillus pumilus (strain SAFR-032)
A4T8L2 5.61e-20 78 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium gilvum (strain PYR-GCK)
Q5Z0Z3 6.01e-20 78 49 2 73 3 rpmE Large ribosomal subunit protein bL31 Nocardia farcinica (strain IFM 10152)
B7GP73 6.98e-20 77 53 2 66 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G3P6 6.98e-20 77 53 2 66 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum (strain NCC 2705)
B3DR50 6.98e-20 77 53 2 66 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum (strain DJO10A)
A5G8U0 7.16e-20 77 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Geotalea uraniireducens (strain Rf4)
B8I1M9 7.42e-20 77 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A8MJY9 8.62e-20 77 50 1 66 3 rpmE Large ribosomal subunit protein bL31 Alkaliphilus oremlandii (strain OhILAs)
Q66V72 1.1e-19 77 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Priestia megaterium
P9WHA1 1.15e-19 77 53 1 65 1 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHA0 1.15e-19 77 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1Z7 1.15e-19 77 53 1 65 1 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AMU2 1.15e-19 77 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KI86 1.15e-19 77 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66188 1.15e-19 77 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B1MLV0 1.19e-19 77 54 2 66 3 rpmE Large ribosomal subunit protein bL31 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A4SD72 1.45e-19 77 55 2 65 3 rpmE Large ribosomal subunit protein bL31 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3EFU5 1.71e-19 77 48 2 72 3 rpmE Large ribosomal subunit protein bL31 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6TK36 1.9e-19 76 51 1 66 3 rpmE Large ribosomal subunit protein bL31 Alkaliphilus metalliredigens (strain QYMF)
Q5KUH0 1.93e-19 76 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Geobacillus kaustophilus (strain HTA426)
B8CZ30 1.94e-19 76 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A1TD67 2.01e-19 77 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A7HZY9 2.17e-19 76 51 1 64 3 rpmE Large ribosomal subunit protein bL31 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q30X20 2.25e-19 76 47 0 65 3 rpmE Large ribosomal subunit protein bL31 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4ITL1 2.27e-19 76 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Geobacillus thermodenitrificans (strain NG80-2)
B3EMY1 2.33e-19 76 51 2 70 3 rpmE Large ribosomal subunit protein bL31 Chlorobium phaeobacteroides (strain BS1)
A7Z9S6 2.53e-19 76 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q03223 2.53e-19 76 46 1 66 1 rpmE Large ribosomal subunit protein bL31 Bacillus subtilis (strain 168)
A0RMQ6 2.65e-19 76 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter fetus subsp. fetus (strain 82-40)
A0PUL2 3.07e-19 76 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium ulcerans (strain Agy99)
B2HQL4 3.07e-19 76 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium marinum (strain ATCC BAA-535 / M)
A1SHH8 3.23e-19 76 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Nocardioides sp. (strain ATCC BAA-499 / JS614)
A1VAL0 4.18e-19 75 46 0 65 3 rpmE Large ribosomal subunit protein bL31 Nitratidesulfovibrio vulgaris (strain DP4)
Q727E3 4.18e-19 75 46 0 65 3 rpmE Large ribosomal subunit protein bL31 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0QB14 4.44e-19 75 44 1 65 3 rpmE Large ribosomal subunit protein bL31 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B9L5T1 4.58e-19 75 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
C6BYQ6 5.44e-19 75 49 0 65 3 rpmE Large ribosomal subunit protein bL31 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B4SER5 5.91e-19 75 50 2 72 3 rpmE Large ribosomal subunit protein bL31 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A8M2K8 6.42e-19 75 47 1 72 3 rpmE Large ribosomal subunit protein bL31 Salinispora arenicola (strain CNS-205)
Q2J6L9 6.46e-19 75 50 1 65 3 rpmE Large ribosomal subunit protein bL31 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q39YQ4 6.65e-19 75 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4J9C1 7.42e-19 75 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A9G9K6 7.56e-19 75 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Sorangium cellulosum (strain So ce56)
B9M0K9 7.73e-19 75 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B8DRV3 7.82e-19 75 47 0 65 3 rpmE Large ribosomal subunit protein bL31 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C5D9P0 9.45e-19 75 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Geobacillus sp. (strain WCH70)
Q180Y7 1.11e-18 74 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Clostridioides difficile (strain 630)
Q24ML8 1.12e-18 74 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Desulfitobacterium hafniense (strain Y51)
B8FZ78 1.12e-18 74 48 1 66 3 rpmE Large ribosomal subunit protein bL31 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q82J69 1.14e-18 75 47 1 72 3 rpmE Large ribosomal subunit protein bL31 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q65DU5 1.16e-18 74 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3ATS5 1.22e-18 74 53 2 66 3 rpmE Large ribosomal subunit protein bL31 Chlorobium chlorochromatii (strain CaD3)
A0LSK3 1.3e-18 75 53 1 65 3 rpmE Large ribosomal subunit protein bL31 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A6Q6S1 1.43e-18 74 43 1 66 3 rpmE Large ribosomal subunit protein bL31 Sulfurovum sp. (strain NBC37-1)
A7ZB82 1.47e-18 74 46 1 65 3 rpmE Large ribosomal subunit protein bL31 Campylobacter concisus (strain 13826)
A7GWB1 1.51e-18 74 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter curvus (strain 525.92)
A1BI58 1.6e-18 74 48 2 70 3 rpmE Large ribosomal subunit protein bL31 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A1ASD4 2.01e-18 73 46 1 64 3 rpmE Large ribosomal subunit protein bL31 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q9K4E5 2.05e-18 74 48 1 70 2 rpmE Large ribosomal subunit protein bL31 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A8ZTL7 2.09e-18 74 43 1 65 3 rpmE Large ribosomal subunit protein bL31 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B1W0B7 2.19e-18 74 50 1 65 3 rpmE Large ribosomal subunit protein bL31 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q47M69 2.37e-18 73 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Thermobifida fusca (strain YX)
A5CYC5 2.69e-18 73 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B3E625 3.23e-18 73 50 1 64 3 rpmE Large ribosomal subunit protein bL31 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A0R215 3.3e-18 73 50 1 65 1 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A8L3V0 3.45e-18 73 49 1 65 3 rpmE Large ribosomal subunit protein bL31 Parafrankia sp. (strain EAN1pec)
A6LQF9 4.34e-18 73 49 2 69 3 rpmE Large ribosomal subunit protein bL31 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A5N3K1 4.45e-18 73 50 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DX85 4.45e-18 73 50 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium kluyveri (strain NBRC 12016)
B4S4H7 5.17e-18 73 46 2 71 3 rpmE Large ribosomal subunit protein bL31 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B7GMH5 5.4e-18 73 43 1 66 3 rpmE Large ribosomal subunit protein bL31 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q2INT4 1.04e-17 73 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Anaeromyxobacter dehalogenans (strain 2CP-C)
C0Z832 1.07e-17 72 45 1 66 3 rpmE Large ribosomal subunit protein bL31 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q0RD99 1.18e-17 72 49 1 65 3 rpmE Large ribosomal subunit protein bL31 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B2A3J2 1.2e-17 72 43 1 66 3 rpmE Large ribosomal subunit protein bL31 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B2TJY1 1.55e-17 72 46 2 69 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Eklund 17B / Type B)
B2UZI1 1.55e-17 72 46 2 69 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Alaska E43 / Type E3)
Q6AJM4 1.73e-17 72 39 1 71 3 rpmE Large ribosomal subunit protein bL31 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q0SQX8 1.92e-17 71 49 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium perfringens (strain SM101 / Type A)
Q8XIB6 1.92e-17 71 49 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium perfringens (strain 13 / Type A)
Q0TNA7 1.92e-17 71 49 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C4Z1S7 1.96e-17 71 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q748A8 2.55e-17 71 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A7G9N8 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IE17 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Okra / Type B1)
C1FQ93 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Kyoto / Type A2)
A5HY31 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KYH1 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain 657 / Type Ba4)
A7FQF8 2.73e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain ATCC 19397 / Type A)
B1KSQ7 3.44e-17 71 46 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium botulinum (strain Loch Maree / Type A3)
Q1IVR7 3.66e-17 71 40 0 65 3 rpmE Large ribosomal subunit protein bL31 Koribacter versatilis (strain Ellin345)
A8ER63 3.69e-17 70 43 1 66 3 rpmE Large ribosomal subunit protein bL31 Aliarcobacter butzleri (strain RM4018)
Q1D230 3.73e-17 71 47 2 73 3 rpmE Large ribosomal subunit protein bL31 Myxococcus xanthus (strain DK1622)
B5YIQ5 4.02e-17 70 46 1 65 3 rpmE Large ribosomal subunit protein bL31 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B3DYW5 4.27e-17 71 46 1 64 3 rpmE Large ribosomal subunit protein bL31 Methylacidiphilum infernorum (isolate V4)
A4XAX7 4.61e-17 70 44 1 72 3 rpmE Large ribosomal subunit protein bL31 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A0LIZ7 4.96e-17 70 44 1 65 3 rpmE Large ribosomal subunit protein bL31 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B0TI73 5.15e-17 70 46 1 66 3 rpmE Large ribosomal subunit protein bL31 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q5SJE1 6.76e-17 70 48 1 64 1 rpmE Large ribosomal subunit protein bL31 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72JR0 6.76e-17 70 48 1 64 1 rpmE Large ribosomal subunit protein bL31 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C4XIQ3 6.84e-17 70 46 0 65 3 rpmE Large ribosomal subunit protein bL31 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A7H1N3 7.73e-17 70 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A6Q5A7 7.84e-17 70 43 1 66 3 rpmE Large ribosomal subunit protein bL31 Nitratiruptor sp. (strain SB155-2)
Q5HX10 7.84e-17 70 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter jejuni (strain RM1221)
A1VXN9 7.84e-17 70 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIX2 7.84e-17 70 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FJW4 7.84e-17 70 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B8FEA3 8.3e-17 70 41 1 65 3 rpmE Large ribosomal subunit protein bL31 Desulfatibacillum aliphaticivorans
Q0AUB6 1e-16 69 47 2 67 3 rpmE Large ribosomal subunit protein bL31 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0Q316 1.09e-16 69 44 2 67 3 rpmE Large ribosomal subunit protein bL31 Clostridium novyi (strain NT)
Q8RDA2 1.58e-16 69 44 2 67 3 rpmE Large ribosomal subunit protein bL31 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2RFV8 1.95e-16 68 44 2 65 3 rpmE Large ribosomal subunit protein bL31 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A4FN40 2.04e-16 69 46 1 65 3 rpmE Large ribosomal subunit protein bL31 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q7ND16 2.18e-16 69 46 0 63 3 rpmE Large ribosomal subunit protein bL31 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q3A926 3.58e-16 68 40 1 66 3 rpmE Large ribosomal subunit protein bL31 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9KDU7 4.89e-16 68 40 1 66 3 rpmE Large ribosomal subunit protein bL31 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B3PMQ1 6.97e-16 67 53 2 63 3 rpmE Large ribosomal subunit protein bL31 Metamycoplasma arthritidis (strain 158L3-1)
Q3ZYN3 1.54e-15 67 44 2 65 3 rpmE Large ribosomal subunit protein bL31 Dehalococcoides mccartyi (strain CBDB1)
B0K1F3 1.68e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Thermoanaerobacter sp. (strain X514)
B0K7H0 1.68e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8F7C6 1.79e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72P39 1.79e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q04YV5 1.79e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04UM1 1.79e-15 66 43 2 67 3 rpmE Large ribosomal subunit protein bL31 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8DZZ9 2.81e-15 66 42 1 64 3 rpmE Large ribosomal subunit protein bL31 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B1I6L4 3.72e-15 65 39 1 66 3 rpmE Large ribosomal subunit protein bL31 Desulforudis audaxviator (strain MP104C)
Q3Z6W1 4.35e-15 65 43 2 65 3 rpmE Large ribosomal subunit protein bL31 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q97F64 4.52e-15 65 40 2 71 3 rpmE Large ribosomal subunit protein bL31 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B5YDA8 6.11e-15 65 42 1 64 3 rpmE Large ribosomal subunit protein bL31 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B3QL18 1.58e-14 64 49 2 61 3 rpmE Large ribosomal subunit protein bL31 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q67TD7 2.01e-14 63 43 2 66 3 rpmE Large ribosomal subunit protein bL31 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B3R0G4 2.26e-14 63 40 0 65 3 rpmE Large ribosomal subunit protein bL31 Phytoplasma mali (strain AT)
Q6KIG2 2.42e-14 63 42 0 70 3 rpmE Large ribosomal subunit protein bL31 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B9MR65 2.9e-14 63 40 2 67 3 rpmE Large ribosomal subunit protein bL31 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B0SMW9 1.36e-13 62 44 1 58 3 rpmE Large ribosomal subunit protein bL31 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SEI3 1.36e-13 62 44 1 58 3 rpmE Large ribosomal subunit protein bL31 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q6YRB0 2.92e-13 61 38 2 72 3 rpmE Large ribosomal subunit protein bL31 Onion yellows phytoplasma (strain OY-M)
C5C1S7 3.59e-13 60 52 1 65 3 rpmE Large ribosomal subunit protein bL31 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
B6INQ0 4.83e-13 60 42 1 68 3 rpmE Large ribosomal subunit protein bL31 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5FNB8 4.86e-13 60 45 1 68 3 rpmE Large ribosomal subunit protein bL31 Gluconobacter oxydans (strain 621H)
A4XJM8 6.64e-13 60 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q7MSH1 8.5e-13 60 41 2 67 3 rpmE Large ribosomal subunit protein bL31 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B7IDB4 9.85e-13 59 43 2 69 3 rpmE Large ribosomal subunit protein bL31 Thermosipho africanus (strain TCF52B)
Q2G8J9 1.38e-12 59 41 1 74 3 rpmE Large ribosomal subunit protein bL31 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0A4Z6 1.48e-12 59 35 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A9BJ07 1.75e-12 59 43 2 66 3 rpmE Large ribosomal subunit protein bL31 Petrotoga mobilis (strain DSM 10674 / SJ95)
A5G1U2 1.95e-12 59 41 1 74 3 rpmE Large ribosomal subunit protein bL31 Acidiphilium cryptum (strain JF-5)
Q2RVH2 2.11e-12 58 42 1 66 3 rpmE Large ribosomal subunit protein bL31 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P58413 2.46e-12 58 51 0 49 3 rpmE Large ribosomal subunit protein bL31 Aquifex aeolicus (strain VF5)
Q4A5T5 2.62e-12 58 36 2 72 3 rpmE Large ribosomal subunit protein bL31 Mycoplasmopsis synoviae (strain 53)
A7HJF3 3.55e-12 58 44 2 68 3 rpmE Large ribosomal subunit protein bL31 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B2GHC3 4.58e-12 58 37 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A6LM69 4.66e-12 58 40 2 69 3 rpmE Large ribosomal subunit protein bL31 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
P66197 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MW2)
A8YY85 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7J0 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MSSA476)
Q6GEV5 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MRSA252)
P66196 7.07e-12 58 34 2 82 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain N315)
P66195 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIW4 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Newman)
Q5HE80 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain COL)
Q2YUN3 7.07e-12 58 34 2 82 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUR5 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain JH9)
Q2FWD8 7.07e-12 58 34 2 82 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF08 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain USA300)
A6U3K5 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain JH1)
A7X4W8 7.07e-12 58 34 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q21B69 8.16e-12 57 44 2 69 3 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain BisB18)
A9HHS1 9.85e-12 57 43 1 67 3 rpmE Large ribosomal subunit protein bL31 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
P66185 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UTS9 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain Shi470)
P66186 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CTX6 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain HPAG1)
B5Z6S4 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain G27)
B6JLD4 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter pylori (strain P12)
Q17XH0 1.02e-11 57 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter acinonychis (strain Sheeba)
Q2NIM2 1.08e-11 57 37 2 72 3 rpmE Large ribosomal subunit protein bL31 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q8CRM8 1.44e-11 57 34 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMA2 1.44e-11 57 34 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q04C49 1.55e-11 57 37 3 77 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBQ0 1.55e-11 57 37 3 77 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q046F1 1.57e-11 57 32 2 81 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q130C9 1.93e-11 56 44 2 69 3 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain BisB5)
B1LAZ7 1.94e-11 56 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Thermotoga sp. (strain RQ2)
B6EHZ6 2.18e-11 57 36 2 84 3 rpmE2 Large ribosomal subunit protein bL31B Aliivibrio salmonicida (strain LFI1238)
Q4L801 2.2e-11 56 32 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus haemolyticus (strain JCSC1435)
Q6AF19 2.37e-11 56 35 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Leifsonia xyli subsp. xyli (strain CTCB07)
A5V3H3 2.58e-11 56 45 2 68 3 rpmE Large ribosomal subunit protein bL31 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B1YEK4 2.63e-11 56 38 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B9DMD3 2.94e-11 56 31 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus carnosus (strain TM300)
Q74LB6 3.36e-11 56 32 2 81 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A5ILC5 3.82e-11 55 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
O54311 3.82e-11 55 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8RG36 3.94e-11 56 38 2 78 3 rpmE Large ribosomal subunit protein bL31 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1WZA2 3.95e-11 56 38 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Halorhodospira halophila (strain DSM 244 / SL1)
Q7VFD3 4.05e-11 55 38 2 67 3 rpmE Large ribosomal subunit protein bL31 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
C1D0Z8 4.61e-11 55 43 1 64 3 rpmE Large ribosomal subunit protein bL31 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B3QFB0 5.34e-11 55 43 2 69 3 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain TIE-1)
Q6NBB0 5.34e-11 55 43 2 69 1 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B2JG54 5.35e-11 55 33 1 77 3 rpmE2 Large ribosomal subunit protein bL31B Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A0ALN3 5.78e-11 55 33 2 83 3 rpmE2 Large ribosomal subunit protein bL31B Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A5ERN6 6.09e-11 55 43 2 69 3 rpmE Large ribosomal subunit protein bL31 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B9E8G3 6.15e-11 55 31 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Macrococcus caseolyticus (strain JCSC5402)
B8H7S3 6.93e-11 55 37 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
B8H4M5 7.6e-11 55 42 2 75 3 rpmE Large ribosomal subunit protein bL31 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3C9 7.6e-11 55 42 2 75 3 rpmE Large ribosomal subunit protein bL31 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A4G310 8.03e-11 55 33 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Herminiimonas arsenicoxydans
Q5FMB6 8.55e-11 55 31 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A6SVL3 8.85e-11 55 31 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Janthinobacterium sp. (strain Marseille)
Q2IRI6 9.03e-11 55 43 2 69 3 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain HaA2)
Q1J0V5 9.79e-11 54 43 1 64 3 rpmE Large ribosomal subunit protein bL31 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q2W2T3 1e-10 55 41 1 68 3 rpmE Large ribosomal subunit protein bL31 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2JUK0 1.07e-10 54 42 2 66 3 rpmE Large ribosomal subunit protein bL31 Synechococcus sp. (strain JA-3-3Ab)
A7N1X4 1.12e-10 55 37 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio campbellii (strain ATCC BAA-1116)
Q2JL69 1.22e-10 54 39 2 71 3 rpmE Large ribosomal subunit protein bL31 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6HAV2 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630R7 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ZK / E33L)
Q814T9 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HFM9 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain B4264)
C1F0Q8 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain 03BB102)
B7JHF3 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain AH820)
Q81JW9 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis
C3LFK5 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P293 1.29e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis (strain A0248)
Q87MC5 1.32e-10 54 35 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4FQE4 1.66e-10 54 37 2 77 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B7HY91 1.7e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain AH187)
Q72XC0 1.7e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ATCC 10987 / NRS 248)
C5CIS7 1.86e-10 53 40 2 66 3 rpmE Large ribosomal subunit protein bL31 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A8YXH9 1.9e-10 54 30 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus helveticus (strain DPC 4571)
Q5NNE1 1.92e-10 54 40 2 75 3 rpmE Large ribosomal subunit protein bL31 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q03T19 2.08e-10 54 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1Q8L9 2.23e-10 54 37 2 77 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
O46917 2.32e-10 53 39 2 66 3 rpl31 Large ribosomal subunit protein bL31c Guillardia theta
A9WSN5 2.85e-10 53 37 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q2S3E3 2.92e-10 53 34 1 67 3 rpmE Large ribosomal subunit protein bL31 Salinibacter ruber (strain DSM 13855 / M31)
B4F280 3e-10 53 36 2 77 3 rpmE2 Large ribosomal subunit protein bL31B Proteus mirabilis (strain HI4320)
B2U9R5 3.23e-10 53 31 1 77 3 rpmE2 Large ribosomal subunit protein bL31B Ralstonia pickettii (strain 12J)
Q38V50 3.23e-10 53 32 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Latilactobacillus sakei subsp. sakei (strain 23K)
Q9K6E9 3.24e-10 53 35 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6FEZ1 3.39e-10 53 34 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1QHM3 3.42e-10 53 42 2 69 3 rpmE Large ribosomal subunit protein bL31 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
C4KYV5 3.53e-10 53 30 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B0REG5 3.67e-10 53 34 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Clavibacter sepedonicus
B7IQY4 3.77e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain G9842)
A5CRQ9 3.79e-10 53 34 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q1GRR1 3.99e-10 53 40 2 75 3 rpmE Large ribosomal subunit protein bL31 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q8EM58 4.25e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3K2D6 4.33e-10 53 30 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P66199 4.47e-10 53 30 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66198 4.47e-10 53 30 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype III (strain NEM316)
B5ZPA7 4.78e-10 53 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K4H4 4.78e-10 53 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PZ23 4.78e-10 53 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Rhizobium etli (strain CIAT 652)
C3PF16 4.85e-10 53 34 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
P0A485 5.29e-10 53 33 2 80 1 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DBG1 5.29e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4a (strain HCC23)
Q71WN0 5.29e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4b (strain F2365)
C1KYW5 5.29e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4b (strain CLIP80459)
P0A486 5.29e-10 53 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A8F7P3 5.32e-10 52 35 2 67 3 rpmE Large ribosomal subunit protein bL31 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q1WV25 6.51e-10 53 30 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Ligilactobacillus salivarius (strain UCC118)
Q07TW1 7.01e-10 52 42 2 69 3 rpmE Large ribosomal subunit protein bL31 Rhodopseudomonas palustris (strain BisA53)
Q836E3 7.02e-10 53 35 2 80 1 rpmE2 Large ribosomal subunit protein bL31B Enterococcus faecalis (strain ATCC 700802 / V583)
Q1MC25 7.24e-10 52 41 2 68 3 rpmE Large ribosomal subunit protein bL31 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1XDJ8 7.37e-10 52 39 2 66 3 rpl31 Large ribosomal subunit protein bL31c Neopyropia yezoensis
Q034T0 7.85e-10 52 32 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAR8 7.85e-10 52 32 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Lacticaseibacillus casei (strain BL23)
Q1GDB7 8.53e-10 52 40 2 69 3 rpmE Large ribosomal subunit protein bL31 Ruegeria sp. (strain TM1040)
B9DRQ0 9.18e-10 52 29 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03L85 9.21e-10 52 29 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4X0 9.21e-10 52 29 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0C3 9.21e-10 52 29 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain CNRZ 1066)
Q7MIE7 9.49e-10 52 34 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio vulnificus (strain YJ016)
Q9TLV5 9.54e-10 52 34 0 67 3 rpl31 Large ribosomal subunit protein bL31c Cyanidium caldarium
C3LTC8 1.03e-09 52 33 1 77 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain M66-2)
Q9KTM4 1.03e-09 52 33 1 77 2 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F342 1.03e-09 52 33 1 77 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8DBH7 1.03e-09 52 35 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio vulnificus (strain CMCP6)
Q8X9T8 1.22e-09 52 35 1 77 3 rpmE2-2 Large ribosomal subunit protein bL31B-2/bL31B-3 Escherichia coli O157:H7
Q3SNZ1 1.27e-09 52 40 2 69 3 rpmE Large ribosomal subunit protein bL31 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q49Z67 1.3e-09 52 30 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A8LMB2 1.36e-09 52 39 2 69 3 rpmE Large ribosomal subunit protein bL31 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q7VYS7 1.38e-09 52 33 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A4VKH1 1.46e-09 52 37 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Stutzerimonas stutzeri (strain A1501)
A5WCS1 1.54e-09 52 33 1 77 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter sp. (strain PRwf-1)
B6JJ31 1.57e-09 52 42 2 69 3 rpmE Large ribosomal subunit protein bL31 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q6NIC5 1.6e-09 52 32 2 85 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C1AX07 1.72e-09 52 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Rhodococcus opacus (strain B4)
P47499 1.74e-09 52 36 2 71 3 rpmE Large ribosomal subunit protein bL31 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q5WB51 2.02e-09 51 33 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Shouchella clausii (strain KSM-K16)
Q8NS12 2.15e-09 52 35 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCL4 2.15e-09 52 35 2 78 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium glutamicum (strain R)
Q5LNE9 2.25e-09 51 38 2 68 3 rpmE Large ribosomal subunit protein bL31 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14555
Feature type CDS
Gene rpmE
Product 50S ribosomal protein L31
Location 91436 - 91651 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)

Contig

Accession ZDB_693
Length 123756 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1755
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01197 Ribosomal protein L31

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0254 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L31

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02909 large subunit ribosomal protein L31 Ribosome -

Protein Sequence

MKKGIHPNYAEITATCSCGNVMKINSTAGHNLNLDVCGECHPFYTGKQRDVASGGRVDRFNKRFSVPSAKK

Flanking regions ( +/- flanking 50bp)

GTCCGGCAAAAAGGCCCGGATAGCGACACGGCCTTAACCGAGGTTTTCCCATGAAAAAAGGTATTCATCCTAACTACGCAGAAATCACTGCAACCTGCTCTTGCGGCAACGTAATGAAAATTAACTCTACCGCAGGTCACAACCTGAACCTGGACGTGTGCGGCGAATGCCACCCGTTCTACACCGGTAAACAGCGTGACGTTGCAAGCGGCGGCCGTGTTGATCGCTTCAACAAACGCTTCAGCGTTCCTTCTGCGAAGAAATAATGGCACTGCGCGGCATGCCGCGCTCTGTTCCATAAAAAACGCCCTGAATG