Homologs in group_1743

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11855 FBDBKF_11855 100.0 Morganella morganii S1 pabA aminodeoxychorismate synthase component II
EHELCC_14450 EHELCC_14450 100.0 Morganella morganii S2 pabA aminodeoxychorismate synthase component II
NLDBIP_15545 NLDBIP_15545 100.0 Morganella morganii S4 pabA aminodeoxychorismate synthase component II
LHKJJB_15065 LHKJJB_15065 100.0 Morganella morganii S3 pabA aminodeoxychorismate synthase component II
F4V73_RS14795 F4V73_RS14795 97.9 Morganella psychrotolerans - aminodeoxychorismate synthase component II
PMI_RS13940 PMI_RS13940 83.8 Proteus mirabilis HI4320 - aminodeoxychorismate synthase component II

Distribution of the homologs in the orthogroup group_1743

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1743

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06195 6.9e-108 310 75 0 190 3 pabA Aminodeoxychorismate synthase component 2 Serratia marcescens
P00901 6.5e-101 292 70 1 191 1 trpG Anthranilate synthase component 2 Pseudomonas putida
P00903 7.2e-101 291 71 1 189 1 pabA Aminodeoxychorismate synthase component 2 Escherichia coli (strain K12)
P06193 1.78e-98 285 68 1 190 3 pabA Aminodeoxychorismate synthase component 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P20576 2.59e-98 286 69 1 191 1 trpG Anthranilate synthase component 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P06194 4.71e-95 277 69 2 190 3 pabA Aminodeoxychorismate synthase component 2 Klebsiella aerogenes
P00902 5.19e-90 264 61 1 191 3 trpG Anthranilate synthase component 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P28819 7.6e-86 254 60 1 190 2 pabA Aminodeoxychorismate/anthranilate synthase component 2 Bacillus subtilis (strain 168)
Q08654 9.97e-70 225 54 3 190 3 trpGD Bifunctional protein TrpGD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P05379 4.31e-69 212 53 2 189 3 trpG Anthranilate synthase component 2 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q1XDC5 5.41e-68 208 52 3 192 4 trpG Anthranilate synthase component 2 Neopyropia yezoensis
P48261 6.75e-67 206 51 3 190 3 trpG Anthranilate synthase component 2 Cyanophora paradoxa
P26922 9.67e-66 203 53 3 191 1 trpG Anthranilate synthase component 2 Azospirillum brasilense
P09575 1.97e-64 205 50 3 189 4 None Multifunctional tryptophan biosynthesis protein (Fragment) Pichia angusta
P51362 3.13e-64 199 52 3 190 4 trpG Anthranilate synthase component 2 Porphyra purpurea
P20409 9.31e-64 212 54 3 188 3 trp1 Multifunctional tryptophan biosynthesis protein Phycomyces blakesleeanus
P00908 5.55e-60 202 51 2 190 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P00937 5.34e-59 194 48 3 189 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WN35 7.28e-58 184 50 3 191 1 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN34 7.28e-58 184 50 3 191 3 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P25170 1.77e-57 196 50 2 190 3 TRPC Multifunctional tryptophan biosynthesis protein Phanerodontia chrysosporium
Q42565 7.74e-57 183 46 6 195 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Arabidopsis thaliana
Q9FJM5 9.02e-57 182 46 6 195 2 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Arabidopsis thaliana
Q7XUS2 3.91e-56 181 46 6 196 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Oryza sativa subsp. japonica
Q57690 5.83e-56 178 46 5 197 3 trpG Anthranilate synthase component 2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P05328 1.08e-55 191 49 2 192 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
P06531 1.15e-55 191 47 2 192 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P24773 1.16e-54 187 47 3 192 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
Q764B9 1.2e-54 177 45 6 195 1 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Oryza sativa subsp. japonica
Q5V632 1.58e-53 172 46 3 188 3 trpG2 Anthranilate synthase component II Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q06129 1.86e-53 172 47 4 195 1 trpG Anthranilate synthase component 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P18483 4.34e-53 183 48 3 192 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus awamori
Q92370 1.62e-51 179 47 4 191 2 trp1 Multifunctional tryptophan biosynthesis protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P20441 7.74e-51 165 44 2 197 3 trpG Anthranilate synthase component 2 Leptospira biflexa
P71381 9.08e-51 165 46 5 197 3 trpG Anthranilate synthase component 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33974 2.29e-49 162 43 5 196 3 trpG Anthranilate synthase component 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O27693 3e-49 161 44 6 200 3 trpG Anthranilate synthase component 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5V214 1.83e-47 157 41 4 191 3 trpG1 Anthranilate synthase component II Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P32483 3.11e-46 164 47 5 188 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
O19914 1.84e-45 151 40 1 190 4 trpG Anthranilate synthase component 2 Cyanidium caldarium
P27627 2.36e-45 151 48 7 194 3 None Aminodeoxychorismate synthase component 2 Streptomyces lividans
Q9HPG6 8.43e-45 150 40 6 197 3 trpG Anthranilate synthase component 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9YGB2 2.16e-44 149 42 8 197 3 trpG Anthranilate synthase component 2 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P00900 2.46e-44 148 41 3 193 1 trpG Anthranilate synthase component 2 Serratia marcescens
P26923 2.71e-44 148 42 6 198 3 trpG Anthranilate synthase component 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P00906 3.14e-44 148 42 4 193 4 trpG-TRPD Anthranilate synthase component II (Fragment) Shigella dysenteriae
P0CN87 3.41e-44 159 41 3 193 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P0CN86 4.33e-44 158 41 3 193 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P27710 4.74e-44 158 41 3 193 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q8ZEG6 1.3e-43 146 40 3 193 3 trpG Anthranilate synthase component 2 Yersinia pestis
Q02003 6.4e-43 145 42 4 191 3 trpG Anthranilate synthase component 2 Lactococcus lactis subsp. lactis (strain IL1403)
P42388 5.29e-42 142 38 3 193 3 trpG Anthranilate synthase component 2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P72539 7.78e-42 152 46 8 193 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
F2RB79 1.21e-41 151 46 8 194 1 cmlB Aminodeoxychorismate synthase Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
P09786 4e-41 140 44 7 196 1 phnB Anthranilate synthase component 2, pyocyanine specific Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P22101 7.37e-41 140 38 5 195 3 trpG Anthranilate synthase component 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P00904 8.78e-41 147 41 4 193 1 trpGD Bifunctional protein TrpGD Escherichia coli (strain K12)
Q9KST3 1.33e-40 139 38 4 196 3 trpG Anthranilate synthase component 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P00905 2.41e-39 143 40 4 193 1 trpGD Bifunctional protein TrpGD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q92411 1.23e-38 143 41 4 193 3 TRP1 Multifunctional tryptophan biosynthesis protein Cochliobolus heterostrophus
Q44696 1.31e-38 134 36 3 193 3 trpG Anthranilate synthase component 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O28670 1.47e-38 133 43 10 191 3 trpG Anthranilate synthase component 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O25868 5.63e-38 132 42 8 190 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJU6 3.08e-37 130 42 8 190 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain J99 / ATCC 700824)
Q89A30 8.05e-36 127 36 4 193 3 trpG Anthranilate synthase component 2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P14952 9.89e-35 120 59 0 87 3 trpG Anthranilate synthase component 2 (Fragment) Acetivibrio thermocellus
P15395 3.47e-33 127 38 5 194 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
Q5Z856 4.16e-33 127 34 7 250 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q6TAS3 1.19e-31 123 35 7 239 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
Q8LPN3 2.11e-31 123 34 7 246 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
P44339 1.68e-29 110 35 5 192 4 HI_1171 Putative anthranilate synthase component II Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P50872 7.16e-29 115 38 3 180 4 trpE(G) Anthranilate synthase Azospirillum brasilense
Q8TXV8 5.69e-26 101 34 6 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q46E00 4.33e-25 99 34 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina barkeri (strain Fusaro / DSM 804)
Q9V0I6 4.91e-25 99 31 3 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus abyssi (strain GE5 / Orsay)
O59071 4.17e-24 96 31 5 191 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8THC7 7.84e-24 95 33 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P06558 1.23e-23 95 34 7 207 3 trpG Anthranilate synthase component 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8U0R9 1.8e-23 95 30 5 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8PXF0 4.32e-23 94 33 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5JFM4 2.61e-22 92 29 3 188 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q0W700 3.73e-21 89 31 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q9HJM3 1.46e-20 87 32 5 190 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q58970 2.33e-20 87 29 4 190 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O26805 5.67e-20 85 28 5 188 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A6UVC9 5.8e-20 85 28 4 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q12UJ5 8.96e-20 85 31 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
O28995 2.76e-19 87 32 2 137 3 carA Carbamoyl phosphate synthase small chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8XHB2 8.19e-19 85 30 6 179 3 carA Carbamoyl phosphate synthase small chain Clostridium perfringens (strain 13 / Type A)
A5UK20 1.67e-18 82 28 5 187 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q2NER5 2.81e-18 81 29 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
P37254 4.92e-18 84 33 6 212 1 ABZ1 Aminodeoxychorismate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O94277 1.91e-17 82 31 8 194 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A9A9L8 2.7e-17 79 28 3 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q8RBK1 4.15e-17 80 33 5 157 3 carA Carbamoyl phosphate synthase small chain Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9K8V6 5.02e-17 80 34 3 143 3 carA Carbamoyl phosphate synthase arginine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A6VH31 6.67e-17 77 29 6 192 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q58425 8.98e-17 80 31 5 163 3 carA Carbamoyl phosphate synthase small chain Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6APU2 8.98e-17 80 31 3 161 3 guaA GMP synthase [glutamine-hydrolyzing] Desulfotalea psychrophila (strain LSv54 / DSM 12343)
O66727 1.17e-16 79 31 3 163 3 carA Carbamoyl phosphate synthase small chain Aquifex aeolicus (strain VF5)
Q6GJQ6 1.99e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MRSA252)
P99105 1.99e-16 79 29 6 191 1 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain N315)
P64296 1.99e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPX0 1.99e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH9)
A6TYP2 1.99e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH1)
A7WY93 1.99e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NY69 2.03e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MW2)
Q6GC81 2.03e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MSSA476)
A4FW79 2.03e-16 76 27 3 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A8Z0R1 2.05e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300 / TCH1516)
A6QE71 2.05e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Newman)
Q5HIQ6 2.05e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain COL)
Q2G0Y6 2.05e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJM5 2.05e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300)
Q2YVL5 2.28e-16 79 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q67Q55 3.6e-16 78 31 6 179 3 carA Carbamoyl phosphate synthase small chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B4S5S1 5.27e-16 78 27 4 175 3 carA Carbamoyl phosphate synthase small chain Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q5HRX1 7.35e-16 78 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6LXA7 7.51e-16 75 36 2 119 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8CMQ8 7.78e-16 78 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
O27079 8e-16 77 29 3 144 3 carA Carbamoyl phosphate synthase small chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9LVW7 8.78e-16 77 27 3 151 1 CARA Carbamoyl phosphate synthase small chain, chloroplastic Arabidopsis thaliana
Q9CF80 9.62e-16 77 28 3 165 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. lactis (strain IL1403)
Q8KGA2 1.43e-15 76 30 4 148 3 carA Carbamoyl phosphate synthase small chain Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9L4N5 1.86e-15 76 28 3 165 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. cremoris (strain MG1363)
O28949 1.98e-15 73 27 5 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8YXQ7 2.83e-15 76 34 8 172 3 carA Carbamoyl phosphate synthase small chain Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5HPY9 3.02e-15 75 32 3 143 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2URJ0 3.21e-15 75 28 3 163 3 carA Carbamoyl phosphate synthase small chain Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
C1D0M2 3.21e-15 76 31 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q9RT91 3.7e-15 76 30 4 188 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B9DLM7 4.33e-15 75 28 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus carnosus (strain TM300)
Q2FL30 4.59e-15 72 29 7 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P63732 5.6e-15 75 29 2 143 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63731 5.6e-15 75 29 2 143 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype III (strain NEM316)
Q8CPJ5 7.03e-15 74 32 3 143 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4L386 9.88e-15 74 29 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus haemolyticus (strain JCSC1435)
Q1J0T4 1.2e-14 74 31 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q979P8 1.26e-14 72 29 5 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A6UQ90 1.62e-14 71 28 7 195 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q92CU0 1.68e-14 74 33 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7UGJ6 1.97e-14 73 27 4 179 3 carA Carbamoyl phosphate synthase small chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6YV23 2.4e-14 73 28 2 139 2 CARA Carbamoyl phosphate synthase small chain, chloroplastic Oryza sativa subsp. japonica
Q6HES7 2.53e-14 73 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81WF1 2.53e-14 73 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bacillus anthracis
P0DA13 2.62e-14 73 29 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XCR8 2.62e-14 73 29 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA12 2.62e-14 73 29 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63735 2.62e-14 73 29 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M1
Q636D9 2.66e-14 73 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ZK / E33L)
P58894 2.67e-14 73 29 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q49UU9 2.83e-14 73 28 6 191 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B9KFL4 3.14e-14 73 34 3 158 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q819S2 4.46e-14 72 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q732I2 4.68e-14 72 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 10987 / NRS 248)
C0QYF1 7.67e-14 72 30 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q7N8W2 8.84e-14 72 31 3 143 3 carA Carbamoyl phosphate synthase small chain Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0AMR3 8.93e-14 72 32 5 166 3 carA Carbamoyl phosphate synthase small chain Maricaulis maris (strain MCS10)
P63734 9.49e-14 71 28 2 143 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63733 9.49e-14 71 28 2 143 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8XZ85 9.93e-14 71 30 4 164 3 carA Carbamoyl phosphate synthase small chain Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9PEC2 1.69e-13 70 30 4 163 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain 9a5c)
Q2S0V0 2.23e-13 70 27 6 197 3 guaA GMP synthase [glutamine-hydrolyzing] Salinibacter ruber (strain DSM 13855 / M31)
P27708 2.32e-13 71 30 5 179 1 CAD Multifunctional protein CAD Homo sapiens
P57245 2.42e-13 70 30 3 136 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B2RQC6 2.5e-13 71 29 4 178 1 Cad Multifunctional protein CAD Mus musculus
Q8Y822 3.16e-13 70 32 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A6F1 3.19e-13 70 30 3 143 1 carA Carbamoyl phosphate synthase small chain Escherichia coli (strain K12)
P0A6F2 3.19e-13 70 30 3 143 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O157:H7
Q8FLB1 3.35e-13 70 30 3 143 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6LKY1 4.04e-13 70 29 6 190 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q49WY3 4.69e-13 69 28 4 163 3 carA Carbamoyl phosphate synthase small chain Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q720X7 4.9e-13 70 32 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serotype 4b (strain F2365)
A0AHK7 4.91e-13 70 32 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Z9L8 5.23e-13 69 28 3 143 3 carA Carbamoyl phosphate synthase small chain Salmonella typhi
Q97FT2 7.55e-13 68 28 3 139 3 carA Carbamoyl phosphate synthase small chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q4L5Q4 1.02e-12 68 30 3 139 3 carA Carbamoyl phosphate synthase small chain Staphylococcus haemolyticus (strain JCSC1435)
Q5HTL3 1.11e-12 68 32 3 163 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni (strain RM1221)
Q5N0L0 1.22e-12 68 32 5 164 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q8G5P4 1.25e-12 68 29 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Bifidobacterium longum (strain NCC 2705)
P08955 1.3e-12 68 30 5 178 1 CAD Multifunctional protein CAD Mesocricetus auratus
Q8RC63 1.47e-12 68 28 4 188 3 guaA GMP synthase [glutamine-hydrolyzing] Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q87EB9 1.54e-12 68 30 4 163 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8DUP4 1.62e-12 68 26 2 142 3 carA Carbamoyl phosphate synthase small chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9PN49 2.03e-12 68 31 3 163 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A3DCD4 2.03e-12 68 27 2 155 3 guaA GMP synthase [glutamine-hydrolyzing] Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8TNY3 2.2e-12 67 31 3 140 3 carA Carbamoyl phosphate synthase small chain Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8Q0U4 2.31e-12 67 31 3 139 3 carA Carbamoyl phosphate synthase small chain Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A8FMV3 2.53e-12 67 32 3 163 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q7UFS3 2.58e-12 67 25 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q97VZ9 2.88e-12 65 31 6 172 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P14845 2.92e-12 67 28 3 143 3 carA Carbamoyl phosphate synthase small chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8CXH8 3.01e-12 67 29 5 157 3 carA Carbamoyl phosphate synthase small chain Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2A5V5 3.17e-12 67 29 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
P58895 3.31e-12 67 29 4 163 3 carA Carbamoyl phosphate synthase small chain Xanthomonas axonopodis pv. citri (strain 306)
P25993 3.4e-12 67 27 4 158 1 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Bacillus subtilis (strain 168)
Q6KZC5 3.44e-12 65 25 5 193 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
B9E8Y0 3.6e-12 67 26 5 190 3 guaA GMP synthase [glutamine-hydrolyzing] Macrococcus caseolyticus (strain JCSC5402)
P63730 4.11e-12 67 28 3 144 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MW2)
Q6GA11 4.11e-12 67 28 3 144 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MSSA476)
P99147 4.11e-12 67 28 3 144 1 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain N315)
P63729 4.11e-12 67 28 3 144 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGN0 4.11e-12 67 28 3 144 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain COL)
Q9KF78 4.15e-12 67 27 4 189 3 guaA Putative GMP synthase [glutamine-hydrolyzing] Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P74587 4.23e-12 67 30 6 152 3 carA Carbamoyl phosphate synthase small chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0B5J1 4.37e-12 64 24 5 189 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
A1W0N3 4.69e-12 67 31 3 163 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q72IE5 4.71e-12 67 27 5 191 3 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SI28 5.19e-12 67 27 5 191 1 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8X239 5.24e-12 64 33 3 119 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q8TY15 5.25e-12 66 26 4 163 3 carA Carbamoyl phosphate synthase small chain Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q91437 5.44e-12 67 30 5 165 2 CAD Multifunctional protein CAD Squalus acanthias
Q9K9V8 5.48e-12 66 26 3 158 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7NHC2 5.81e-12 67 30 3 154 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q65MU0 6.32e-12 66 26 3 189 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4XKX8 6.37e-12 66 31 3 154 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
C5BQ30 6.55e-12 66 29 6 179 3 carA Carbamoyl phosphate synthase small chain Teredinibacter turnerae (strain ATCC 39867 / T7901)
A8FAH5 7.08e-12 66 27 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus pumilus (strain SAFR-032)
Q0BY73 7.21e-12 66 31 5 166 3 carA Carbamoyl phosphate synthase small chain Hyphomonas neptunium (strain ATCC 15444)
Q6GHN3 7.26e-12 66 28 3 144 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MRSA252)
A5N5D9 7.56e-12 66 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYY7 7.56e-12 66 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain NBRC 12016)
Q7M8K2 9.47e-12 66 30 5 191 3 guaA GMP synthase [glutamine-hydrolyzing] Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q50983 9.99e-12 65 30 4 144 3 carA Carbamoyl phosphate synthase small chain Neisseria gonorrhoeae
Q31LB7 1.07e-11 65 31 7 171 3 carA Carbamoyl phosphate synthase small chain Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A8LAX2 1.31e-11 65 29 2 154 3 guaA GMP synthase [glutamine-hydrolyzing] Parafrankia sp. (strain EAN1pec)
B0S0S7 1.38e-11 65 29 2 155 3 guaA GMP synthase [glutamine-hydrolyzing] Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q6F8M7 1.5e-11 65 27 4 171 3 carA Carbamoyl phosphate synthase small chain Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A6TLR3 1.64e-11 65 28 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Alkaliphilus metalliredigens (strain QYMF)
Q73ER7 1.68e-11 65 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9JVZ6 1.87e-11 65 30 4 144 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A7I131 2.02e-11 65 27 3 190 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q2SCJ3 2.06e-11 65 25 6 197 3 guaA GMP synthase [glutamine-hydrolyzing] Hahella chejuensis (strain KCTC 2396)
P58896 2.36e-11 64 30 5 163 3 carA Carbamoyl phosphate synthase small chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
O66601 2.37e-11 65 26 4 188 3 guaA GMP synthase [glutamine-hydrolyzing] Aquifex aeolicus (strain VF5)
O08317 2.37e-11 64 30 6 169 2 carA Carbamoyl phosphate synthase arginine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3AD70 2.39e-11 65 31 2 154 3 guaA GMP synthase [glutamine-hydrolyzing] Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q891G7 2.39e-11 65 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium tetani (strain Massachusetts / E88)
Q8EHS6 2.44e-11 64 27 4 163 3 carA Carbamoyl phosphate synthase small chain Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8RSS4 3.13e-11 64 30 3 135 3 carA Carbamoyl phosphate synthase small chain Halomonas eurihalina
P52557 3.16e-11 64 29 4 148 3 carA Carbamoyl phosphate synthase small chain Bacillus caldolyticus
Q756B7 3.47e-11 64 32 2 146 3 GUA1 GMP synthase [glutamine-hydrolyzing] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q8U086 3.47e-11 64 31 4 130 3 carA Carbamoyl phosphate synthase small chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9JXX4 3.48e-11 64 30 4 144 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C4XRH8 3.6e-11 64 26 4 163 3 carA Carbamoyl phosphate synthase small chain Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9KPH8 3.64e-11 64 30 3 143 3 carA Carbamoyl phosphate synthase small chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q81IS3 3.94e-11 64 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A9BER7 3.96e-11 64 28 7 192 3 guaA GMP synthase [glutamine-hydrolyzing] Petrotoga mobilis (strain DSM 10674 / SJ95)
Q5WJI0 3.98e-11 64 32 5 157 3 guaA GMP synthase [glutamine-hydrolyzing] Shouchella clausii (strain KSM-K16)
Q3ITY2 4.03e-11 62 26 5 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8UDF7 4.33e-11 64 30 6 179 3 carA Carbamoyl phosphate synthase small chain Agrobacterium fabrum (strain C58 / ATCC 33970)
P36838 4.33e-11 63 29 3 154 3 carA Carbamoyl phosphate synthase arginine-specific small chain Bacillus subtilis (strain 168)
B7IHI2 4.85e-11 64 28 4 188 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho africanus (strain TCF52B)
A7H2D2 5.08e-11 63 31 3 163 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A7Z235 5.23e-11 63 27 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P59576 5.52e-11 63 27 3 149 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B7H4Q8 5.7e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain B4264)
Q4WFT3 5.95e-11 63 31 4 154 1 gua1 GMP synthase [glutamine-hydrolyzing] Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O19886 6.03e-11 63 27 6 165 3 carA Carbamoyl phosphate synthase small chain Cyanidium caldarium
E4QHI6 6.03e-11 63 30 5 156 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain N40)
Q974T4 6.15e-11 62 32 3 118 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B7IUT1 7.03e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain G9842)
B1YIZ1 7.89e-11 63 28 7 192 3 guaA GMP synthase [glutamine-hydrolyzing] Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P38625 8.09e-11 63 33 6 148 1 GUA1 GMP synthase [glutamine-hydrolyzing] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q30TH8 8.2e-11 63 29 3 160 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B7JM61 8.83e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain AH820)
Q81VE0 8.83e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis
B9MS76 8.91e-11 63 29 2 154 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q63GV4 9.54e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ZK / E33L)
C1EUB4 9.54e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain 03BB102)
A0R8W7 9.54e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis (strain Al Hakam)
C3L508 9.54e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBL1 9.54e-11 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain A0248)
Q6HPC6 1.02e-10 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis subsp. konkukian (strain 97-27)
A9VQG9 1.05e-10 63 29 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus mycoides (strain KBAB4)
Q8DKU5 1.17e-10 62 29 7 171 3 carA Carbamoyl phosphate synthase small chain Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q18990 1.21e-10 63 30 3 130 1 pyr-1 Multifunctional protein pyr-1 Caenorhabditis elegans
Q8RG87 1.29e-10 62 26 4 142 3 carA Carbamoyl phosphate synthase small chain Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q73LZ4 1.38e-10 62 29 2 155 3 guaA GMP synthase [glutamine-hydrolyzing] Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q31F66 1.59e-10 62 23 4 194 3 guaA GMP synthase [glutamine-hydrolyzing] Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q47LQ0 1.64e-10 62 27 2 147 3 guaA GMP synthase [glutamine-hydrolyzing] Thermobifida fusca (strain YX)
P44335 1.83e-10 62 25 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG27 1.99e-10 62 25 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain PittGG)
Q87SF4 2.22e-10 62 29 3 143 3 carA Carbamoyl phosphate synthase small chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SXM1 2.22e-10 62 28 6 183 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q92N95 2.35e-10 62 29 5 179 3 carA Carbamoyl phosphate synthase small chain Rhizobium meliloti (strain 1021)
Q6ASN4 2.37e-10 62 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
P60502 2.49e-10 62 30 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Spiroplasma kunkelii
C1A3W7 2.59e-10 62 33 4 157 3 guaA GMP synthase [glutamine-hydrolyzing] Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q9CNX8 2.78e-10 62 25 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Pasteurella multocida (strain Pm70)
A8ETA7 3.44e-10 61 30 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Aliarcobacter butzleri (strain RM4018)
Q3A450 3.81e-10 61 23 3 162 3 carA Carbamoyl phosphate synthase small chain Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7MNU1 4.06e-10 61 28 3 143 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain YJ016)
Q8DEM1 4.47e-10 61 28 3 143 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain CMCP6)
Q3Z886 4.5e-10 61 31 5 154 3 guaA GMP synthase [glutamine-hydrolyzing] Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q6LUK6 4.68e-10 61 28 3 143 3 carA Carbamoyl phosphate synthase small chain Photobacterium profundum (strain SS9)
P0CL64 4.79e-10 61 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P38098 5.05e-10 60 29 3 140 3 carA Carbamoyl phosphate synthase small chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54324 5.93e-10 60 28 6 176 1 carA Carbamoyl phosphate synthase arginine-specific small chain Geobacillus stearothermophilus
A7GKG1 5.97e-10 60 28 4 158 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q98IA7 6.42e-10 60 28 5 180 3 carA Carbamoyl phosphate synthase small chain Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P29727 6.95e-10 60 25 3 189 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus subtilis (strain 168)
A6VHH7 7.1e-10 60 25 2 140 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
C3LT21 7.1e-10 60 24 4 190 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio cholerae serotype O1 (strain M66-2)
Q9KTW2 7.1e-10 60 24 4 190 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3F1 7.1e-10 60 24 4 190 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1AQJ8 7.39e-10 60 26 3 162 3 guaA GMP synthase [glutamine-hydrolyzing] Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A5UAR3 7.4e-10 60 25 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain PittEE)
B2TIX3 8.9e-10 60 25 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Eklund 17B / Type B)
B2UZ05 9.69e-10 60 25 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Alaska E43 / Type E3)
B1ZNB4 9.78e-10 60 35 4 119 3 guaA GMP synthase [glutamine-hydrolyzing] Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A9A972 9.82e-10 60 25 2 140 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
B2G994 9.99e-10 60 29 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY3 9.99e-10 60 29 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri (strain DSM 20016)
Q8K9Z6 1.02e-09 60 27 3 136 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2H132 1.12e-09 60 30 4 131 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
C6C0A9 1.17e-09 60 29 5 146 3 carA Carbamoyl phosphate synthase small chain Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q87S07 1.17e-09 60 24 4 190 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6QBI5 1.18e-09 60 29 6 192 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurovum sp. (strain NBC37-1)
B8I4P0 1.19e-09 60 27 2 155 3 guaA GMP synthase [glutamine-hydrolyzing] Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q7MNE1 1.22e-09 60 23 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio vulnificus (strain YJ016)
Q8DF07 1.23e-09 60 23 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio vulnificus (strain CMCP6)
B9M9G4 1.33e-09 60 28 4 160 3 guaA GMP synthase [glutamine-hydrolyzing] Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q036Y5 1.34e-09 60 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W952 1.34e-09 60 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus casei (strain BL23)
B2RIF9 1.52e-09 59 29 3 144 3 guaA GMP synthase [glutamine-hydrolyzing] Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q3A590 1.55e-09 59 27 3 162 3 guaA GMP synthase [glutamine-hydrolyzing] Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B0U0B2 1.56e-09 59 25 5 188 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A1VA26 1.59e-09 59 26 6 169 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DP4)
Q726J4 1.59e-09 59 26 6 169 1 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q0I2D2 1.61e-09 59 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Histophilus somni (strain 129Pt)
Q0VNF0 1.67e-09 59 24 6 201 3 guaA GMP synthase [glutamine-hydrolyzing] Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3THK7 1.74e-09 59 34 3 116 1 Gmps GMP synthase [glutamine-hydrolyzing] Mus musculus
Q5N2F8 1.75e-09 59 29 3 151 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q18KM8 1.78e-09 57 27 7 195 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
B8D0Z5 1.95e-09 59 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
O93937 1.99e-09 59 29 3 141 3 pyrABCN Multifunctional protein pyrABCN Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0KJS0 1.99e-09 59 25 6 204 3 guaA GMP synthase [glutamine-hydrolyzing] Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4FMW8 2.06e-09 59 26 5 190 3 guaA GMP synthase [glutamine-hydrolyzing] Pelagibacter ubique (strain HTCC1062)
Q5FMD6 2.13e-09 59 28 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q17YH9 2.23e-09 59 30 5 163 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter acinonychis (strain Sheeba)
Q5V1K0 2.32e-09 57 26 5 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9PMG8 2.37e-09 58 27 5 168 3 carA Carbamoyl phosphate synthase small chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B8IZS6 2.64e-09 58 26 6 185 3 carA Carbamoyl phosphate synthase small chain Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q7MWL9 2.69e-09 58 29 3 144 3 guaA GMP synthase [glutamine-hydrolyzing] Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q4V7C6 2.7e-09 59 33 3 116 1 Gmps GMP synthase [glutamine-hydrolyzing] Rattus norvegicus
Q6LWW5 2.7e-09 58 25 2 140 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A6WZJ5 2.7e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5B1L4 2.76e-09 58 30 4 151 3 gua1 GMP synthase [glutamine-hydrolyzing] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B6EGZ6 2.76e-09 58 24 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio salmonicida (strain LFI1238)
Q046I2 2.95e-09 58 29 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A4IXW6 3.06e-09 58 25 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q6C0 3.06e-09 58 25 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. novicida (strain U112)
Q8XI46 3.32e-09 58 27 4 156 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium perfringens (strain 13 / Type A)
A0Q2S8 3.42e-09 58 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium novyi (strain NT)
Q7VLE9 3.47e-09 58 25 5 196 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8Y664 3.64e-09 58 27 3 143 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q74LF7 3.7e-09 58 29 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B7JXM2 4.08e-09 58 29 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Rippkaea orientalis (strain PCC 8801 / RF-1)
A4G0Y3 4.15e-09 58 25 2 140 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q3ZXH7 4.47e-09 58 31 5 153 3 guaA GMP synthase [glutamine-hydrolyzing] Dehalococcoides mccartyi (strain CBDB1)
Q8FZJ8 4.47e-09 58 27 6 180 3 carA Carbamoyl phosphate synthase small chain Brucella suis biovar 1 (strain 1330)
A9M6F1 4.47e-09 58 27 6 180 3 carA Carbamoyl phosphate synthase small chain Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A5VRM1 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YIB8 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REC2 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 2 (strain ATCC 23457)
Q57C28 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella abortus biovar 1 (strain 9-941)
Q2YM22 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain 2308)
B2S6U9 4.56e-09 58 27 6 179 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain S19)
Q66ER8 4.83e-09 58 26 3 139 3 carA Carbamoyl phosphate synthase small chain Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZIL5 4.83e-09 58 26 3 139 3 carA Carbamoyl phosphate synthase small chain Yersinia pestis
B0USI5 4.84e-09 58 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Histophilus somni (strain 2336)
P38099 4.87e-09 58 27 5 170 3 carA Carbamoyl phosphate synthase small chain Stutzerimonas stutzeri
B0CHS0 4.87e-09 58 27 6 180 3 carA Carbamoyl phosphate synthase small chain Brucella suis (strain ATCC 23445 / NCTC 10510)
Q97FM9 4.95e-09 58 27 4 156 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6D0C8 4.95e-09 58 28 3 139 3 carA Carbamoyl phosphate synthase small chain Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MU26 5.11e-09 58 24 4 190 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio campbellii (strain ATCC BAA-1116)
B1XLR5 5.22e-09 58 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q88DU5 5.42e-09 58 28 3 140 3 carA Carbamoyl phosphate synthase small chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O25165 5.48e-09 58 27 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain ATCC 700392 / 26695)
A1SYT6 5.64e-09 58 23 4 197 3 guaA GMP synthase [glutamine-hydrolyzing] Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q73U79 5.8e-09 58 27 5 161 3 guaA GMP synthase [glutamine-hydrolyzing] Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P22572 5.92e-09 58 30 4 131 1 arg-2 Carbamoyl phosphate synthase arginine-specific small chain Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B3QYF4 6.05e-09 58 31 6 164 3 guaA GMP synthase [glutamine-hydrolyzing] Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B0BUF0 6.08e-09 58 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MZV8 6.08e-09 58 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B5Z842 6.63e-09 57 27 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain G27)
Q67S57 6.71e-09 57 27 6 177 3 guaA GMP synthase [glutamine-hydrolyzing] Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B0TI09 7.45e-09 57 27 4 157 3 guaA GMP synthase [glutamine-hydrolyzing] Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A8GHV1 7.57e-09 57 27 6 196 3 guaA GMP synthase [glutamine-hydrolyzing] Serratia proteamaculans (strain 568)
Q9RWI4 7.94e-09 57 28 4 140 3 carA Carbamoyl phosphate synthase small chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q5E763 8.36e-09 57 23 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q71YI0 8.51e-09 57 26 3 143 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serotype 4b (strain F2365)
Q5NG38 8.68e-09 57 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HJ0 8.68e-09 57 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. tularensis (strain FSC 198)
B8GNX4 8.81e-09 57 26 4 163 3 carA Carbamoyl phosphate synthase small chain Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A9IWF8 9.02e-09 57 29 5 158 3 carA Carbamoyl phosphate synthase small chain Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q87WP3 9.05e-09 57 25 4 170 3 carA Carbamoyl phosphate synthase small chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1XUM3 9.11e-09 57 26 4 163 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q4QNW4 9.14e-09 57 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain 86-028NP)
Q9L0H2 9.5e-09 57 26 3 158 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B6JMN5 9.96e-09 57 28 4 189 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain P12)
Q6CU71 1.01e-08 57 29 3 147 3 GUA1 GMP synthase [glutamine-hydrolyzing] Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9WZ28 1.06e-08 57 27 6 175 3 carA Carbamoyl phosphate synthase small chain Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2UFN0 1.09e-08 57 29 6 167 3 gua1 GMP synthase [glutamine-hydrolyzing] Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A6TCC2 1.12e-08 57 25 4 195 3 guaA GMP synthase [glutamine-hydrolyzing] Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q09580 1.13e-08 57 28 1 143 3 gmps-1 Probable GMP synthase [glutamine-hydrolyzing] Caenorhabditis elegans
Q89DR8 1.23e-08 57 28 4 164 3 carA Carbamoyl phosphate synthase small chain Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4YI77 1.26e-08 57 29 5 148 3 carA Carbamoyl phosphate synthase small chain Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q8D3H7 1.27e-08 57 27 3 135 3 carA Carbamoyl phosphate synthase small chain Wigglesworthia glossinidia brevipalpis
P87183 1.35e-08 57 33 3 103 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Hypocrea virens
Q7U7F9 1.41e-08 57 28 8 179 3 carA Carbamoyl phosphate synthase small chain Parasynechococcus marenigrum (strain WH8102)
Q0IE37 1.44e-08 57 30 6 160 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9311)
Q822V6 1.56e-08 57 32 6 163 3 guaA GMP synthase [glutamine-hydrolyzing] Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9CKV3 1.57e-08 56 26 5 172 3 carA Carbamoyl phosphate synthase small chain Pasteurella multocida (strain Pm70)
Q5SLL3 1.58e-08 56 27 3 137 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GZ0 1.58e-08 56 27 3 137 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5RA96 1.58e-08 57 32 3 116 2 GMPS GMP synthase [glutamine-hydrolyzing] Pongo abelii
P49915 1.61e-08 57 32 3 116 1 GMPS GMP synthase [glutamine-hydrolyzing] Homo sapiens
Q9A4J7 1.62e-08 56 28 5 164 3 carA Carbamoyl phosphate synthase small chain Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O85192 1.73e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus rhamnosus
B7VJU8 1.78e-08 56 22 3 188 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio atlanticus (strain LGP32)
Q1H280 1.81e-08 56 25 4 196 3 guaA GMP synthase [glutamine-hydrolyzing] Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B5FAY1 1.94e-08 56 25 4 188 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio fischeri (strain MJ11)
A2R9B9 1.95e-08 56 30 5 134 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A1BD85 1.97e-08 56 26 6 194 3 guaA GMP synthase [glutamine-hydrolyzing] Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A4SM23 2.01e-08 56 25 6 203 3 guaA GMP synthase [glutamine-hydrolyzing] Aeromonas salmonicida (strain A449)
A6Q4N8 2.02e-08 56 29 4 159 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratiruptor sp. (strain SB155-2)
B9KH18 2.07e-08 56 36 5 122 3 guaA GMP synthase [glutamine-hydrolyzing] Anaplasma marginale (strain Florida)
Q2RGP2 2.07e-08 56 29 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5P9L5 2.11e-08 56 36 5 122 3 guaA GMP synthase [glutamine-hydrolyzing] Anaplasma marginale (strain St. Maries)
Q5LTN6 2.15e-08 56 27 5 170 3 carA Carbamoyl phosphate synthase small chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
P07259 2.16e-08 56 29 6 181 1 URA2 Multifunctional protein URA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P05990 2.16e-08 56 29 3 141 1 r Multifunctional protein r Drosophila melanogaster
Q1IWN0 2.25e-08 56 28 4 140 3 carA Carbamoyl phosphate synthase small chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
P58893 2.32e-08 56 29 5 148 3 carA Carbamoyl phosphate synthase small chain Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q1WRY8 2.37e-08 56 29 4 157 3 guaA GMP synthase [glutamine-hydrolyzing] Ligilactobacillus salivarius (strain UCC118)
Q1CSM2 2.38e-08 56 29 2 154 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain HPAG1)
C5BER5 2.42e-08 56 26 4 194 3 guaA GMP synthase [glutamine-hydrolyzing] Edwardsiella ictaluri (strain 93-146)
Q6FUF3 2.45e-08 56 31 6 149 3 GUA1 GMP synthase [glutamine-hydrolyzing] Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
A7GIN0 2.45e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IFD1 2.45e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Okra / Type B1)
A5I720 2.47e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FYP0 2.47e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain ATCC 19397 / Type A)
B1L1J7 2.52e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Loch Maree / Type A3)
P51201 2.54e-08 56 28 7 165 3 carA Carbamoyl phosphate synthase small chain Porphyra purpurea
C3KUC5 2.62e-08 56 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain 657 / Type Ba4)
Q7S8A6 2.63e-08 56 28 4 175 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q4HXF0 2.69e-08 56 32 8 153 3 GUA1 GMP synthase [glutamine-hydrolyzing] Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q0BLV0 2.89e-08 56 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. holarctica (strain OSU18)
A7NCA3 2.89e-08 56 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q2A3D4 2.94e-08 55 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. holarctica (strain LVS)
Q38ZE1 3.09e-08 55 27 5 159 3 guaA GMP synthase [glutamine-hydrolyzing] Latilactobacillus sakei subsp. sakei (strain 23K)
B5XNM4 3.1e-08 55 25 4 195 3 guaA GMP synthase [glutamine-hydrolyzing] Klebsiella pneumoniae (strain 342)
A3PA84 3.11e-08 55 26 4 160 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9301)
Q6AD51 3.24e-08 55 29 5 161 3 guaA GMP synthase [glutamine-hydrolyzing] Leifsonia xyli subsp. xyli (strain CTCB07)
Q6B940 3.27e-08 55 27 7 173 3 carA Carbamoyl phosphate synthase small chain Gracilaria tenuistipitata var. liui
A1VEV0 3.42e-08 55 25 1 156 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratidesulfovibrio vulgaris (strain DP4)
Q72D86 3.42e-08 55 25 1 156 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q2U913 3.44e-08 55 30 5 132 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B2KCS8 3.48e-08 55 25 3 154 3 guaA GMP synthase [glutamine-hydrolyzing] Elusimicrobium minutum (strain Pei191)
B9L0W3 3.58e-08 55 28 3 153 3 guaA GMP synthase [glutamine-hydrolyzing] Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
C6DBG3 3.61e-08 55 27 7 197 3 guaA GMP synthase [glutamine-hydrolyzing] Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C6BSD8 3.62e-08 55 24 3 190 3 guaA GMP synthase [glutamine-hydrolyzing] Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
C1FLV2 4.05e-08 55 26 3 157 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Kyoto / Type A2)
Q7N3K4 4.2e-08 55 24 3 194 3 guaA GMP synthase [glutamine-hydrolyzing] Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q92AH2 4.4e-08 55 26 3 143 3 carA Carbamoyl phosphate synthase small chain Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6F1C4 5.08e-08 55 36 3 119 3 guaA GMP synthase [glutamine-hydrolyzing] Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q7VP66 5.11e-08 55 29 6 165 3 carA Carbamoyl phosphate synthase small chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4L8C4 5.27e-08 55 26 6 200 3 guaA GMP synthase [glutamine-hydrolyzing] Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8CXK8 5.43e-08 55 27 4 157 3 guaA GMP synthase [glutamine-hydrolyzing] Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2UUF1 5.63e-08 55 28 3 155 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain Shi470)
C1CQS0 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Taiwan19F-14)
P64298 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64297 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1ICM9 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Hungary19A-6)
C1C842 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain 70585)
B5E5U0 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 19F (strain G54)
Q04JQ8 5.88e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0RQD7 5.9e-08 55 29 2 157 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter fetus subsp. fetus (strain 82-40)
B2IQR1 5.94e-08 55 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain CGSP14)
A8AC69 6.22e-08 53 26 4 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q9HSH4 6.25e-08 53 28 9 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B8F3T2 6.6e-08 55 23 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Glaesserella parasuis serovar 5 (strain SH0165)
C1CF29 6.71e-08 55 27 8 192 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain JJA)
B8ZKZ5 6.71e-08 55 27 8 192 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B3H120 6.92e-08 55 24 3 193 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
C4Z3X1 6.99e-08 55 23 3 156 3 guaA GMP synthase [glutamine-hydrolyzing] Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
P77885 7.02e-08 54 25 4 143 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B3PIG3 7.12e-08 55 26 6 198 3 guaA GMP synthase [glutamine-hydrolyzing] Cellvibrio japonicus (strain Ueda107)
Q59968 7.18e-08 54 30 6 145 3 carA Carbamoyl phosphate synthase small chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
B2SGK4 7.23e-08 54 24 5 189 3 guaA GMP synthase [glutamine-hydrolyzing] Francisella tularensis subsp. mediasiatica (strain FSC147)
Q8KZA0 7.27e-08 54 24 5 173 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q9ZKG4 7.83e-08 54 28 4 159 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain J99 / ATCC 700824)
Q6D288 7.98e-08 54 26 6 196 3 guaA GMP synthase [glutamine-hydrolyzing] Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7NSG1 7.98e-08 54 27 7 167 3 guaA GMP synthase [glutamine-hydrolyzing] Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0T212 8.69e-08 54 26 5 195 3 guaA GMP synthase [glutamine-hydrolyzing] Shigella flexneri serotype 5b (strain 8401)
Q1DUF5 8.72e-08 54 29 4 131 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Coccidioides immitis (strain RS)
B8DNB9 8.72e-08 54 23 2 156 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q6BLS3 8.79e-08 54 29 3 147 3 GUA1 GMP synthase [glutamine-hydrolyzing] Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14185
Feature type CDS
Gene pabA
Product aminodeoxychorismate synthase component II
Location 8248 - 8823 (strand: -1)
Length 576 (nucleotides) / 191 (amino acids)
In genomic island -

Contig

Accession ZDB_693
Length 123756 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1743
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00117 Glutamine amidotransferase class-I

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0512 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)
EH Anthranilate/para-aminobenzoate synthase component II (glutamine amidotransferase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01664 para-aminobenzoate synthetase component II [EC:2.6.1.85] Folate biosynthesis
Biosynthesis of cofactors
-

Protein Sequence

MLLIIDNYDSFTYNLYQYFCELGADVQVKRNDAVSLSDIEQLSPSHLVISPGPCTPSEAGISLDAVSHFAGEIPILGVCLGHQAIGQAFGAQVVKARKVMHGKTTAIHHNQQGVFKGLNRPLTVTRYHSLVIAPETLPASFEVTAWSLHDGNVDEIMGIRHKTLPIEGVQFHPESILSEQGHELLNNFLKY

Flanking regions ( +/- flanking 50bp)

AGCAGTTTGAAAATAAAAAAGATAAATATATCAGTCGGATATAGATAATCATGCTATTAATTATCGATAATTATGACTCATTTACTTATAACCTGTATCAATACTTCTGTGAGTTAGGTGCAGATGTACAGGTTAAACGAAATGATGCCGTCAGCCTCAGTGATATTGAGCAATTATCGCCATCTCACCTGGTGATCTCACCGGGTCCCTGCACGCCGTCAGAAGCCGGTATTTCACTGGATGCGGTCAGCCATTTCGCCGGTGAAATCCCGATCCTCGGGGTGTGTCTCGGGCATCAGGCTATCGGCCAGGCATTCGGCGCGCAGGTGGTGAAGGCGCGTAAAGTGATGCACGGCAAAACCACAGCAATCCATCATAATCAGCAGGGTGTGTTCAAAGGGCTGAACCGTCCGCTGACCGTCACCCGCTATCACTCGCTGGTGATTGCCCCGGAAACATTGCCTGCCTCGTTTGAGGTTACCGCCTGGAGTCTGCATGACGGCAATGTGGATGAAATCATGGGGATCCGCCATAAAACCCTGCCGATTGAAGGTGTGCAGTTCCATCCGGAAAGTATTCTCAGTGAACAGGGGCATGAACTCCTGAATAATTTCCTGAAATACTAATCAGTTATCGCTTATTTTATCCCCGGTTCTGTTTTTTCATTCGTTTTGAT