Homologs in group_1613

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10615 FBDBKF_10615 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_14950 EHELCC_14950 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_14780 NLDBIP_14780 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_14565 LHKJJB_14565 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS07900 F4V73_RS07900 37.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS14325 F4V73_RS14325 86.4 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_1613

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1613

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55681 7.71e-10 55 38 0 70 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P15017 2.43e-08 51 34 1 86 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q9ZD50 5.9e-07 47 40 0 65 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q92HV3 2.18e-06 46 38 0 65 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P96631 1.63e-05 43 27 0 87 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)
P0C5S2 1.7e-05 44 33 0 62 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 1.7e-05 44 33 0 62 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P55360 3.24e-05 43 36 0 50 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WMH9 3.71e-05 43 26 2 110 1 Rv0474 Uncharacterized HTH-type transcriptional regulator Rv0474 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMH8 3.71e-05 43 26 2 110 4 MT0491 Uncharacterized HTH-type transcriptional regulator MT0491 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P71049 9.14e-05 42 31 2 91 4 slrR HTH-type transcriptional regulator SlrR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_13185
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 56212 - 56544 (strand: -1)
Length 333 (nucleotides) / 110 (amino acids)

Contig

Accession ZDB_691
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1613
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MMKKYAISEAIGQVIRQYRTNAGLTTKQLAHRIGISQQQLSRYERGVNRIDVDTLLRVSLAFKLTPGRFFEEMNMTGTGLDDILYENEEGDIQEIRMSLIADSIISPRDF

Flanking regions ( +/- flanking 50bp)

GTGAGCTAAATAAGGAATTTTAGTGATGGTCTTTATAGGGTTATTGATTAATGATGAAGAAATATGCGATATCCGAAGCTATCGGACAGGTTATCAGACAATACCGGACCAATGCAGGTTTAACCACAAAGCAGCTGGCACACAGAATAGGGATTAGCCAGCAGCAGCTCTCGCGTTATGAGCGGGGGGTAAACCGTATTGATGTGGATACGTTGTTGCGTGTCAGTCTGGCCTTTAAACTCACTCCGGGTCGTTTCTTTGAGGAAATGAATATGACCGGCACCGGGCTGGATGACATTCTTTATGAAAATGAAGAAGGGGATATTCAGGAAATCCGGATGAGCCTTATTGCGGACAGTATTATTTCCCCGCGCGATTTTTAATCACCATAATTTCCGCTTTTAAATAAAAAAGACAGACCAGTACAGCTGAT