Homologs in group_190

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08580 FBDBKF_08580 100.0 Morganella morganii S1 sfsB putative transcriptional regulator, lambda repressor-like DNA-binding domain
EHELCC_12945 EHELCC_12945 100.0 Morganella morganii S2 sfsB putative transcriptional regulator, lambda repressor-like DNA-binding domain
NLDBIP_13285 NLDBIP_13285 100.0 Morganella morganii S4 sfsB putative transcriptional regulator, lambda repressor-like DNA-binding domain
LHKJJB_13270 LHKJJB_13270 100.0 Morganella morganii S3 sfsB putative transcriptional regulator, lambda repressor-like DNA-binding domain
F4V73_RS09805 F4V73_RS09805 93.2 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS16960 F4V73_RS16960 66.7 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS04690 PMI_RS04690 64.7 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS16930 PMI_RS16930 80.7 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_190

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_190

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACH4 1.05e-29 103 65 0 80 3 sfsB Sugar fermentation stimulation protein B Shigella flexneri
P0ACH1 1.05e-29 103 65 0 80 3 sfsB Sugar fermentation stimulation protein B Escherichia coli (strain K12)
P0ACH2 1.05e-29 103 65 0 80 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACH3 1.05e-29 103 65 0 80 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O157:H7
P06903 2.63e-21 82 56 0 67 2 ner Negative regulator of transcription Escherichia phage D108
P06020 3.94e-21 82 61 0 63 1 ner Negative regulator of transcription Escherichia phage Mu
P46496 8.12e-12 58 40 0 67 3 nlp Mu-like prophage FluMu DNA-binding protein Ner Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11760
Feature type CDS
Gene sfsB
Product putative transcriptional regulator, lambda repressor-like DNA-binding domain
Location 64408 - 64674 (strand: 1)
Length 267 (nucleotides) / 88 (amino acids)

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_190
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF13693 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3423 Transcription (K) K Predicted transcriptional regulator, lambda repressor-like DNA-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07724 Ner family transcriptional regulator - -

Protein Sequence

MDSGKSDWHPADIIASLKKRGTTLAALSRSAGLSSSTLANALSRPWPKGEWLIADFLAVHPSEIWPSRYFNSITGELLDRKIRVKVTN

Flanking regions ( +/- flanking 50bp)

TATTTATACCACTAACACAACATTAATCTAAAATAAAAAGGACTCAATATATGGATTCCGGTAAATCTGACTGGCACCCTGCTGATATAATTGCATCGCTGAAGAAACGGGGGACAACCCTGGCCGCCTTGTCGCGCAGTGCGGGACTCAGCTCCTCAACGCTTGCTAACGCGCTTTCCCGGCCGTGGCCGAAGGGTGAATGGCTCATCGCAGACTTTCTCGCCGTCCATCCGTCAGAGATTTGGCCCAGCCGTTATTTTAATTCTATCACAGGTGAATTATTAGATAGGAAAATAAGAGTGAAGGTAACTAATTAATTTCAATATATACTTATAAAAACAATAAAACCGCTAATCGTAATTAGCGG